Summary

P0DMW4

Homolog: Q96HG1.
Function: Small integral membrane protein 10.

Statistics

Total GO Annotation: 15
Unique PROST Go: 15
Unique BLAST Go: 0

Total Homologs: 19
Unique PROST Homologs: 15
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q96HG1 (Small integral membrane protein 10) with a FATCAT P-Value: 1.92e-11 and RMSD of 0.88 angstrom. The sequence alignment identity is 69.0%.
Structural alignment shown in left. Query protein P0DMW4 colored as red in alignment, homolog Q96HG1 colored as blue. Query protein P0DMW4 is also shown in right top, homolog Q96HG1 showed in right bottom. They are colored based on secondary structures. 

  P0DMW4 MAA--SAA-LSA---AAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE 78
  Q96HG1 MEALGSGHYVGGSIRSMAAAALSGLAVRLSRPQGTRGSYGAFCKTLTRTLLTFFDLAWRLRKNFFYFYILASVILNVHLQVYI- 83

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:1990414 replication-born double-strand break repair via sister chromatid exchange
2. P GO:0019054 modulation by virus of host cellular process
2. P GO:0039635 suppression by virus of host peptidoglycan biosynthetic process
2. P GO:0044659 viral release from host cell by cytolysis
2. P GO:0039640 viral release by cytolysis via suppression of host peptidoglycan biosynthetic process
2. P GO:0019835 cytolysis
2. P GO:0006312 mitotic recombination
2. P GO:0005739 mitochondrion
2. P GO:0005741 mitochondrial outer membrane
2. P GO:0008009 chemokine activity
2. P GO:0016021 integral component of membrane
2. P GO:0004857 enzyme inhibitor activity
2. P GO:0000741 karyogamy
2. P GO:0010197 polar nucleus fusion
2. P GO:0020002 host cell plasma membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P0DMW4 Small integral membrane protein 10-like protein 2A 0 4.02e-136 1.73e-48
1. PB P0DMW3 Small integral membrane protein 10-like protein 1 1.04e-03 2.65e-09 1.56e-24
1. PB Q96HG1 Small integral membrane protein 10 1.92e-11 1.11e-08 5.37e-32
1. PB P0DMW5 Small integral membrane protein 10-like protein 2B 4.06e-09 4.02e-136 1.73e-48
2. P A1L4Q6 Putative uncharacterized protein FLJ41423 1.50e-01 5.23e-03 NA
2. P P34249 Uncharacterized protein YKL102C 2.44e-01 9.35e-05 NA
2. P Q3E7A3 Uncharacterized protein YJL133C-A 6.37e-05 2.88e-06 NA
2. P P19778 Insertion element IS2 uncharacterized 11.1 kDa protein 3.84e-03 5.15e-04 NA
2. P P47010 Putative uncharacterized protein IRC9 4.93e-06 1.47e-03 NA
2. P P52461 Putative CC-type chemokine U83 NA 9.21e-03 NA
2. P Q6UXU0 Putative uncharacterized protein UNQ9165/PRO28630 6.39e-01 3.94e-02 NA
2. P Q93ZJ3 Protein NUCLEAR FUSION DEFECTIVE 6, mitochondrial 9.32e-02 7.33e-05 NA
2. P P38350 Putative uncharacterized protein YBR277C 6.20e-02 2.03e-03 NA
2. P P25640 Putative uncharacterized protein YCR064C 1.16e-01 2.34e-02 NA
2. P P03639 Lysis protein E NA 9.42e-04 NA
2. P O13578 Putative uncharacterized protein YLR415C, mitochondrial 1.03e-03 1.88e-02 NA
2. P P03294 Uncharacterized protein F-121 NA 1.49e-03 NA
2. P A0A023PZI4 Putative uncharacterized membrane protein YHR069C-A 2.17e-01 6.06e-04 NA
2. P P07930 Lysis protein NA 1.36e-02 NA