Summary

P0DO92

Homolog: P0DO93.
Function: Putative protein T-ENOL.

Statistics

Total GO Annotation: 16
Unique PROST Go: 16
Unique BLAST Go: 0

Total Homologs: 8
Unique PROST Homologs: 6
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P0DO93 (Putative protein T-ENOL) with a FATCAT P-Value: 9.82e-07 and RMSD of 2.51 angstrom. The sequence alignment identity is 57.8%.
Structural alignment shown in left. Query protein P0DO92 colored as red in alignment, homolog P0DO93 colored as blue. Query protein P0DO92 is also shown in right top, homolog P0DO93 showed in right bottom. They are colored based on secondary structures. 

  P0DO92 MASTPMGNEGEKKSSWPSQAAPSLRGG-PASLSRSEEYLSQISAELMEEALCTACCHLNPVPIKKKQSQDQATQISKRAFFTKT------ 83
  P0DO93 MAST-SARSGDKKDTWPIQAAASLGGGQKASLSRSEEFLTRISTELTDEALFTARSHMNPMPDKEKQTKDQGTQISRHVFFTKTRGTDTR 89

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0001070 RNA-binding transcription regulator activity
2. P GO:0010494 cytoplasmic stress granule
2. P GO:0044196 host cell nucleolus
2. P GO:0005179 hormone activity
2. P GO:0061572 actin filament bundle organization
2. P GO:0031005 filamin binding
2. P GO:1900158 negative regulation of bone mineralization involved in bone maturation
2. P GO:0097746 blood vessel diameter maintenance
2. P GO:0008217 regulation of blood pressure
2. P GO:0003723 RNA binding
2. P GO:0048705 skeletal system morphogenesis
2. P GO:0005102 signaling receptor binding
2. P GO:0010717 regulation of epithelial to mesenchymal transition
2. P GO:0061182 negative regulation of chondrocyte development
2. P GO:0050434 positive regulation of viral transcription
2. P GO:0032432 actin filament bundle

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P0DO92 Putative protein T-ENOL 0 2.34e-128 1.71e-56
1. PB P0DO93 Putative protein T-ENOL 9.82e-07 2.58e-05 6.76e-29
2. P P32544 Protein Tat NA 3.03e-06 NA
2. P P20920 Protein Tat NA 3.03e-06 NA
2. P P21857 Urotensin-2 (Fragments) 1.37e-02 1.25e-04 NA
2. P Q5H9J7 Protein BEX5 4.08e-02 3.65e-06 NA
2. P Q5ZIU1 Mapk-regulated corepressor-interacting protein 1 1.92e-02 4.89e-02 NA
2. P Q6ZTI6 Refilin-A 5.25e-01 1.05e-02 NA