Summary

P0DO97

Homolog: Q9C717.
Function: Protein FLX-like 3.

Statistics

Total GO Annotation: 172
Unique PROST Go: 172
Unique BLAST Go: 0

Total Homologs: 122
Unique PROST Homologs: 121
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q9C717 (Protein FLX-like 3) with a FATCAT P-Value: 1.93e-09 and RMSD of 2.66 angstrom. The sequence alignment identity is 20.1%.
Structural alignment shown in left. Query protein P0DO97 colored as red in alignment, homolog Q9C717 colored as blue. Query protein P0DO97 is also shown in right top, homolog Q9C717 showed in right bottom. They are colored based on secondary structures. 

  P0DO97 -------------------MMPVDVCP-RD--RGSQWV------WLEMGQCYSKKSVVPESDTSERSSMTS--GSSESD---IPQENKVSKASLDTGQMA 67
  Q9C717 MSGRNRIHRDIRDSYHDHR----DLPPERPFLRGPPLLQPPPPSLLE--DLQIQEGEIRRQDAEIRRLLSDNHGLAD-DRMVLERELVAAKEELH--RMN 91

  P0DO97 FTLAQLES-LEICLKEAEEKAKALSEQLSVSEGTKSKLLEQVSRLE---EKLEAVDHKEASGGPYEKMVLVKDQCIQKLQ----------AEVKASQEQL 153
  Q9C717 LMISDLRAEQDLQLREFSEKRHKLEGDVRAMESYK-K---EASQLRGEVQKLDEI-KRELSGN---VQLLRKD--LAKLQSDNKQIPGMRAEVKDLQKEL 181

  P0DO97 I-AQ-KLKHEKKVK-KL----QTDLATANAITV---LE-LNEKIKTLYEGKPAPREDSLLEGFCG--GLP-PVEEGDRKISLIMELSTQVSLQTERITQL 239
  Q9C717 MHARDAIEYEKKEKFELMEQRQT-ME-KNMVSMAREVEKLRAELATV-DSRP--------WGFGGSYGMNYNNMDGTFRGS-YGENDTYLG-SSER-SQY 267

  P0DO97 KEVLEEKERKIQQLEAERSPHPPQEVKDPPGCLPEAPVFSTHDIPPVVSDENL 292
  Q9C717 YSHGSGSQKK-PRL--DR--H-------------------------------- 283

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0045616 regulation of keratinocyte differentiation
2. P GO:0099184 structural constituent of postsynaptic intermediate filament cytoskeleton
2. P GO:0050772 positive regulation of axonogenesis
2. P GO:0097539 ciliary transition fiber
2. P GO:0098831 presynaptic active zone cytoplasmic component
2. P GO:0060050 positive regulation of protein glycosylation
2. P GO:0072497 mesenchymal stem cell differentiation
2. P GO:0090161 Golgi ribbon formation
2. P GO:0005874 microtubule
2. P GO:0045111 intermediate filament cytoskeleton
2. P GO:0043034 costamere
2. P GO:0045095 keratin filament
2. P GO:0033693 neurofilament bundle assembly
2. P GO:0048786 presynaptic active zone
2. P GO:2000146 negative regulation of cell motility
2. P GO:0030424 axon
2. P GO:0045109 intermediate filament organization
2. P GO:0034451 centriolar satellite
2. P GO:0098882 structural constituent of presynaptic active zone
2. P GO:1900147 regulation of Schwann cell migration
2. P GO:0032091 negative regulation of protein binding
2. P GO:0097449 astrocyte projection
2. P GO:0005911 cell-cell junction
2. P GO:0044877 protein-containing complex binding
2. P GO:0030426 growth cone
2. P GO:0060020 Bergmann glial cell differentiation
2. P GO:0051707 response to other organism
2. P GO:0007030 Golgi organization
2. P GO:0008017 microtubule binding
2. P GO:0045214 sarcomere organization
2. P GO:0007020 microtubule nucleation
2. P GO:0051645 Golgi localization
2. P GO:0048790 maintenance of presynaptic active zone structure
2. P GO:0120103 centriolar subdistal appendage
2. P GO:0097191 extrinsic apoptotic signaling pathway
2. P GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
2. P GO:0140297 DNA-binding transcription factor binding
2. P GO:0030018 Z disc
2. P GO:0090166 Golgi disassembly
2. P GO:0098978 glutamatergic synapse
2. P GO:0090630 activation of GTPase activity
2. P GO:0043000 Golgi to plasma membrane CFTR protein transport
2. P GO:0099160 postsynaptic intermediate filament cytoskeleton
2. P GO:0005815 microtubule organizing center
2. P GO:0002756 MyD88-independent toll-like receptor signaling pathway
2. P GO:0005921 gap junction
2. P GO:0010977 negative regulation of neuron projection development
2. P GO:0008356 asymmetric cell division
2. P GO:0030054 cell junction
2. P GO:0001750 photoreceptor outer segment
2. P GO:0070062 extracellular exosome
2. P GO:0010507 negative regulation of autophagy
2. P GO:0014704 intercalated disc
2. P GO:0060706 cell differentiation involved in embryonic placenta development
2. P GO:0007098 centrosome cycle
2. P GO:0042995 cell projection
2. P GO:0019901 protein kinase binding
2. P GO:0044299 C-fiber
2. P GO:1902488 cholangiocyte apoptotic process
2. P GO:0000922 spindle pole
2. P GO:0045104 intermediate filament cytoskeleton organization
2. P GO:0071944 cell periphery
2. P GO:0005883 neurofilament
2. P GO:0043025 neuronal cell body
2. P GO:0005198 structural molecule activity
2. P GO:0048167 regulation of synaptic plasticity
2. P GO:0042383 sarcolemma
2. P GO:0042622 photoreceptor outer segment membrane
2. P GO:0010457 centriole-centriole cohesion
2. P GO:0008104 protein localization
2. P GO:0001520 outer dense fiber
2. P GO:0036464 cytoplasmic ribonucleoprotein granule
2. P GO:0030165 PDZ domain binding
2. P GO:0090306 meiotic spindle assembly
2. P GO:0097386 glial cell projection
2. P GO:0045098 type III intermediate filament
2. P GO:0005880 nuclear microtubule
2. P GO:0070779 D-aspartate import across plasma membrane
2. P GO:0030280 structural constituent of skin epidermis
2. P GO:0031234 extrinsic component of cytoplasmic side of plasma membrane
2. P GO:0007130 synaptonemal complex assembly
2. P GO:0005856 cytoskeleton
2. P GO:0061676 importin-alpha family protein binding
2. P GO:0010269 response to selenium ion
2. P GO:0043195 terminal bouton
2. P GO:0044297 cell body
2. P GO:0060252 positive regulation of glial cell proliferation
2. P GO:0098574 cytoplasmic side of lysosomal membrane
2. P GO:0042734 presynaptic membrane
2. P GO:0032580 Golgi cisterna membrane
2. P GO:0071222 cellular response to lipopolysaccharide
2. P GO:0097110 scaffold protein binding
2. P GO:0043292 contractile fiber
2. P GO:0007535 donor selection
2. P GO:0051225 spindle assembly
2. P GO:0010564 regulation of cell cycle process
2. P GO:0071225 cellular response to muramyl dipeptide
2. P GO:0016010 dystrophin-associated glycoprotein complex
2. P GO:1990830 cellular response to leukemia inhibitory factor
2. P GO:0034142 toll-like receptor 4 signaling pathway
2. P GO:0060291 long-term synaptic potentiation
2. P GO:0030500 regulation of bone mineralization
2. P GO:0000904 cell morphogenesis involved in differentiation
2. P GO:0014002 astrocyte development
2. P GO:0031674 I band
2. P GO:0035024 negative regulation of Rho protein signal transduction
2. P GO:0016363 nuclear matrix
2. P GO:0043209 myelin sheath
2. P GO:0010625 positive regulation of Schwann cell proliferation
2. P GO:0072686 mitotic spindle
2. P GO:0033209 tumor necrosis factor-mediated signaling pathway
2. P GO:0030134 COPII-coated ER to Golgi transport vesicle
2. P GO:0006486 protein glycosylation
2. P GO:0097450 astrocyte end-foot
2. P GO:0098641 cadherin binding involved in cell-cell adhesion
2. P GO:0008385 IkappaB kinase complex
2. P GO:0097512 cardiac myofibril
2. P GO:0036064 ciliary basal body
2. P GO:0008092 cytoskeletal protein binding
2. P GO:0098685 Schaffer collateral - CA1 synapse
2. P GO:0000445 THO complex part of transcription export complex
2. P GO:0007010 cytoskeleton organization
2. P GO:0090307 mitotic spindle assembly
2. P GO:0043204 perikaryon
2. P GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
2. P GO:0051580 regulation of neurotransmitter uptake
2. P GO:1990498 mitotic spindle microtubule
2. P GO:0009750 response to fructose
2. P GO:0031594 neuromuscular junction
2. P GO:0010467 gene expression
2. P GO:0098794 postsynapse
2. P GO:0051289 protein homotetramerization
2. P GO:0051599 response to hydrostatic pressure
2. P GO:0034454 microtubule anchoring at centrosome
2. P GO:0030154 cell differentiation
2. P GO:0005814 centriole
2. P GO:0016327 apicolateral plasma membrane
2. P GO:0005200 structural constituent of cytoskeleton
2. P GO:0016082 synaptic vesicle priming
2. P GO:1903445 protein transport from ciliary membrane to plasma membrane
2. P GO:0005798 Golgi-associated vesicle
2. P GO:0098982 GABA-ergic synapse
2. P GO:0016021 integral component of membrane
2. P GO:0031267 small GTPase binding
2. P GO:0045107 intermediate filament polymerization
2. P GO:0007252 I-kappaB phosphorylation
2. P GO:0099635 voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels
2. P GO:0019900 kinase binding
2. P GO:0031102 neuron projection regeneration
2. P GO:0005813 centrosome
2. P GO:0032991 protein-containing complex
2. P GO:0097284 hepatocyte apoptotic process
2. P GO:0045103 intermediate filament-based process
2. P GO:0098973 structural constituent of postsynaptic actin cytoskeleton
2. P GO:0000795 synaptonemal complex
2. P GO:0070652 HAUS complex
2. P GO:0014069 postsynaptic density
2. P GO:1904714 regulation of chaperone-mediated autophagy
2. P GO:0000137 Golgi cis cisterna
2. P GO:0005882 intermediate filament
2. P GO:0005801 cis-Golgi network
2. P GO:0007274 neuromuscular synaptic transmission
2. P GO:0035556 intracellular signal transduction
2. P GO:0005916 fascia adherens
2. P GO:0019905 syntaxin binding
2. P GO:0031667 response to nutrient levels
2. P GO:0060052 neurofilament cytoskeleton organization
2. P GO:0070307 lens fiber cell development
2. P GO:0070365 hepatocyte differentiation
2. P GO:0042802 identical protein binding
2. P GO:0048788 cytoskeleton of presynaptic active zone
2. P GO:1990254 keratin filament binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P0DO97 Coiled-coil domain-containing protein 192 0 1.33e-123 0.0
2. P Q5U465 Coiled-coil domain-containing protein 125 3.39e-05 8.19e-04 NA
2. P Q9NUQ3 Gamma-taxilin 3.39e-07 1.55e-04 NA
2. P Q9H1L0 Uncharacterized protein MIR1-1HG 2.12e-02 2.07e-02 NA
2. P Q6IFX4 Keratin, type I cytoskeletal 39 9.37e-07 2.58e-04 NA
2. P P48676 Peripherin 1.51e-05 1.11e-04 NA
2. P Q08379 Golgin subfamily A member 2 3.01e-03 3.94e-04 NA
2. P Q99M74 Keratin, type II cuticular Hb2 1.82e-06 1.83e-02 NA
2. P P17661 Desmin 2.39e-06 2.87e-03 NA
2. P Q7Z3Y9 Keratin, type I cytoskeletal 26 4.27e-06 6.07e-04 NA
2. P Q9P7J4 THO complex subunit mft1 4.56e-06 2.03e-05 NA
2. P P48675 Desmin 6.02e-06 4.99e-04 NA
2. P Q5EB94 Myocardial zonula adherens protein 9.14e-05 1.46e-07 NA
2. P P24790 Vimentin-4 1.02e-04 2.17e-03 NA
2. P Q5D525 Synaptonemal complex central element protein 1-like 1.90e-07 3.71e-02 NA
2. P Q3UIJ9 Myocardial zonula adherens protein 5.89e-06 1.80e-08 NA
2. P Q5BJY9 Keratin, type I cytoskeletal 18 2.77e-07 2.26e-02 NA
2. P Q5K2P2 Keratin, type I cytoskeletal 15 (Fragment) 7.43e-08 1.53e-02 NA
2. P Q6A163 Keratin, type I cytoskeletal 39 2.59e-05 1.69e-03 NA
2. P P40214 Protein FDO1 1.98e-05 2.56e-03 NA
2. P P02541 Desmin 2.76e-07 9.47e-04 NA
2. P Q148H7 Keratin, type II cytoskeletal 79 4.20e-06 4.19e-02 NA
2. P A3KN27 Keratin, type II cytoskeletal 74 4.98e-06 7.07e-03 NA
2. P P23729 Type III intermediate filament 1.51e-06 2.24e-04 NA
2. P Q5BJF6 Outer dense fiber protein 2 5.15e-04 2.20e-02 NA
2. P Q6PH08 ERC protein 2 6.44e-04 4.20e-03 NA
2. P P48673 Vimentin beta 2.39e-05 3.37e-04 NA
2. P Q6IFW3 Keratin, type I cytoskeletal 39 9.13e-07 7.81e-04 NA
2. P P48670 Vimentin (Fragment) 2.94e-08 5.42e-05 NA
2. P P47819 Glial fibrillary acidic protein 1.21e-04 1.38e-02 NA
2. P B4YNF1 Uncharacterized protein V11 NA 4.64e-03 NA
2. P P08729 Keratin, type II cytoskeletal 7 9.24e-07 2.89e-02 NA
2. P Q9D9F8 Mirror-image polydactyly gene 1 protein homolog 1.26e-07 5.22e-07 NA
2. P P31393 Plasticin 8.52e-06 4.62e-04 NA
2. P P11679 Keratin, type II cytoskeletal 8 7.06e-06 8.25e-03 NA
2. P Q96KP6 TNFAIP3-interacting protein 3 8.90e-07 2.36e-03 NA
2. P Q148H6 Keratin, type I cytoskeletal 28 4.22e-06 9.54e-03 NA
2. P Q62839 Golgin subfamily A member 2 5.06e-04 2.24e-04 NA
2. P O15083 ERC protein 2 1.00e-03 1.31e-02 NA
2. P P15331 Peripherin 1.21e-06 2.47e-02 NA
2. P Q6IME9 Keratin, type II cytoskeletal 72 3.18e-05 3.09e-02 NA
2. P Q9UJT2 Testis-specific serine kinase substrate 1.51e-05 4.89e-02 NA
2. P Q0VCF3 Suppressor of IKBKE 1 1.33e-07 8.11e-04 NA
2. P O62654 Desmin 9.74e-07 3.15e-03 NA
2. P Q9C717 Protein FLX-like 3 1.93e-09 5.29e-04 NA
2. P Q6IG03 Keratin, type II cytoskeletal 73 3.59e-06 5.53e-03 NA
2. P Q09350 Uncharacterized protein T09B9.4 8.12e-06 1.69e-02 NA
2. P Q58EE9 Glial fibrillary acidic protein 4.87e-06 6.82e-04 NA
2. P P08552 Neurofilament medium polypeptide (Fragment) 1.02e-07 6.95e-04 NA
2. P Q8AVR2 FGFR1 oncogene partner 2 homolog 2.22e-07 1.22e-02 NA
2. P P24789 Vimentin-1/2 2.28e-05 2.55e-04 NA
2. P Q8BHN1 Gamma-taxilin 4.59e-08 2.07e-02 NA
2. P Q7ZTS4 Keratin, type I cytoskeletal 18 3.21e-07 3.93e-03 NA
2. P Q8L7S4 Microtubule-associated protein 70-2 1.55e-04 5.33e-03 NA
2. P A9UM82 Myocardial zonula adherens protein 5.64e-07 7.96e-04 NA
2. P Q16352 Alpha-internexin 5.00e-08 2.70e-06 NA
2. P Q5K2N9 Keratin, type I cytoskeletal 18 5.56e-07 1.51e-03 NA
2. P P02540 Desmin 1.48e-07 4.56e-03 NA
2. P Q5BK57 HAUS augmin-like complex subunit 8 4.40e-07 3.00e-05 NA
2. P Q8K3M6 ERC protein 2 2.47e-03 1.51e-02 NA
2. P Q6IG04 Keratin, type II cytoskeletal 72 9.76e-06 1.08e-02 NA
2. P Q8VYU6 Golgin candidate 4 6.24e-05 1.47e-02 NA
2. P P48674 Vimentin 3.06e-07 6.62e-04 NA
2. P P02542 Desmin 3.47e-05 2.38e-05 NA
2. P Q9CPR7 Suppressor of IKBKE 1 1.14e-07 1.63e-02 NA
2. P Q497I4 Keratin, type I cuticular Ha5 2.45e-06 1.85e-02 NA
2. P P31000 Vimentin 4.67e-05 4.85e-02 NA
2. P P46660 Alpha-internexin 1.68e-05 8.40e-07 NA
2. P P03995 Glial fibrillary acidic protein 1.64e-06 1.78e-02 NA
2. P Q6QUW1 Retrograde protein of 51 kDa 6.82e-08 9.89e-03 NA
2. P P35617 Low molecular weight neuronal intermediate filament 1.64e-06 5.25e-05 NA
2. P Q75AS0 Topoisomerase I damage affected protein 11 3.17e-04 3.90e-03 NA
2. P P41219 Peripherin 1.32e-05 1.11e-03 NA
2. P P05783 Keratin, type I cytoskeletal 18 3.35e-07 3.24e-03 NA
2. P Q8N998 Coiled-coil domain-containing protein 89 1.18e-06 1.14e-02 NA
2. P A0JMQ7 Microtubule-associated tumor suppressor 1 homolog A 4.70e-06 1.20e-02 NA
2. P Q3TRJ4 Keratin, type I cytoskeletal 26 2.09e-05 1.56e-03 NA
2. P Q5K2P4 Keratin, type I cytoskeletal 13 1.59e-06 1.09e-04 NA
2. P A6H712 Keratin, type I cytoskeletal 26 4.75e-04 1.56e-03 NA
2. P Q6IFZ9 Keratin, type II cytoskeletal 74 1.76e-06 1.53e-02 NA
2. P Q08DH7 Alpha-internexin 3.37e-07 2.12e-06 NA
2. P A7YWK3 Keratin, type II cytoskeletal 73 1.13e-05 3.40e-02 NA
2. P P31001 Desmin 5.48e-07 6.43e-04 NA
2. P Q10758 Keratin, type II cytoskeletal 8 1.42e-07 3.24e-03 NA
2. P Q7Z3Y7 Keratin, type I cytoskeletal 28 2.07e-07 2.99e-02 NA
2. P Q7RTS7 Keratin, type II cytoskeletal 74 1.41e-05 6.46e-03 NA
2. P P23239 Desmin 6.27e-06 1.21e-04 NA
2. P Q07427 Keratin, type I cytoskeletal 18 2.22e-07 3.04e-02 NA
2. P Q0VCP9 Coiled-coil domain-containing protein 149 5.07e-08 9.04e-06 NA
2. P Q5R561 FGFR1 oncogene partner 2 homolog 1.10e-07 3.12e-02 NA
2. P Q811U3 ELKS/Rab6-interacting/CAST family member 1 1.27e-03 5.14e-03 NA
2. P Q5XFN2 Desmin 1.35e-07 4.48e-03 NA
2. P Q14CN4 Keratin, type II cytoskeletal 72 4.04e-06 1.65e-02 NA
2. P P23565 Alpha-internexin 9.76e-07 1.95e-05 NA
2. P Q9U389 Allophagy receptor allo-1 6.91e-07 4.52e-03 NA
2. P P05787 Keratin, type II cytoskeletal 8 2.89e-07 1.33e-02 NA
2. P Q99L00 HAUS augmin-like complex subunit 8 1.46e-04 2.07e-02 NA
2. P Q5K2P6 Keratin, type 1 cytoskeletal 11 1.41e-06 3.40e-05 NA
2. P P0CAP1 Myocardial zonula adherens protein 9.50e-05 1.49e-07 NA
2. P P21807 Peripherin 4.95e-06 1.16e-02 NA
2. P Q86Z20 Coiled-coil domain-containing protein 125 4.29e-06 6.01e-04 NA
2. P Q9NUD7 Uncharacterized protein C20orf96 3.82e-08 3.98e-04 NA
2. P Q92155 Vimentin 1.46e-05 4.86e-03 NA
2. P Q9TSV3 Coiled-coil alpha-helical rod protein 1 (Fragment) 3.22e-07 2.76e-03 NA
2. P Q8IYJ2 Uncharacterized protein C10orf67, mitochondrial 5.40e-04 1.11e-05 NA
2. P P08778 Keratin, type I cytoskeletal 47 kDa 1.09e-07 7.20e-03 NA
2. P Q5FWT9 Suppressor of IKBKE 1 2.22e-07 9.54e-03 NA
2. P Q6NXH9 Keratin, type II cytoskeletal 73 6.80e-05 3.42e-03 NA
2. P A6QQJ3 Peripherin 3.14e-08 3.44e-04 NA
2. P Q2NL98 Vimentin-type intermediate filament-associated coiled-coil protein 9.30e-06 3.40e-02 NA
2. P Q9BT25 HAUS augmin-like complex subunit 8 1.60e-04 2.11e-03 NA
2. P A1KQY9 Keratin, type I cytoskeletal 18-A 2.78e-08 1.40e-02 NA
2. P Q17QG3 RILP-like protein 1 3.68e-06 1.25e-03 NA
2. P Q9H2F9 Coiled-coil domain-containing protein 68 1.38e-05 3.35e-02 NA
2. P P05784 Keratin, type I cytoskeletal 18 3.45e-07 6.82e-03 NA
2. P P08776 Keratin, type II cytoskeletal 8 6.19e-06 3.98e-02 NA
2. P Q921M4 Golgin subfamily A member 2 1.00e-03 2.76e-04 NA
2. P Q01240 60 kDa neurofilament protein 8.12e-07 4.57e-04 NA
2. P P09654 Vimentin 8.63e-08 8.64e-03 NA
2. P A8MT33 Synaptonemal complex central element protein 1-like 8.83e-06 8.03e-07 NA
2. P O76013 Keratin, type I cuticular Ha6 2.22e-06 4.53e-04 NA
2. P Q8BVC4 Coiled-coil domain-containing protein 68 3.17e-06 1.04e-04 NA