Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
Q9C717
(Protein FLX-like 3) with a FATCAT P-Value: 1.93e-09 and RMSD of 2.66 angstrom. The sequence alignment identity is 20.1%.
Structural alignment shown in left. Query protein P0DO97 colored as red in alignment, homolog Q9C717 colored as blue.
Query protein P0DO97 is also shown in right top, homolog Q9C717 showed in right bottom. They are colored based on secondary structures.
P0DO97 -------------------MMPVDVCP-RD--RGSQWV------WLEMGQCYSKKSVVPESDTSERSSMTS--GSSESD---IPQENKVSKASLDTGQMA 67 Q9C717 MSGRNRIHRDIRDSYHDHR----DLPPERPFLRGPPLLQPPPPSLLE--DLQIQEGEIRRQDAEIRRLLSDNHGLAD-DRMVLERELVAAKEELH--RMN 91 P0DO97 FTLAQLES-LEICLKEAEEKAKALSEQLSVSEGTKSKLLEQVSRLE---EKLEAVDHKEASGGPYEKMVLVKDQCIQKLQ----------AEVKASQEQL 153 Q9C717 LMISDLRAEQDLQLREFSEKRHKLEGDVRAMESYK-K---EASQLRGEVQKLDEI-KRELSGN---VQLLRKD--LAKLQSDNKQIPGMRAEVKDLQKEL 181 P0DO97 I-AQ-KLKHEKKVK-KL----QTDLATANAITV---LE-LNEKIKTLYEGKPAPREDSLLEGFCG--GLP-PVEEGDRKISLIMELSTQVSLQTERITQL 239 Q9C717 MHARDAIEYEKKEKFELMEQRQT-ME-KNMVSMAREVEKLRAELATV-DSRP--------WGFGGSYGMNYNNMDGTFRGS-YGENDTYLG-SSER-SQY 267 P0DO97 KEVLEEKERKIQQLEAERSPHPPQEVKDPPGCLPEAPVFSTHDIPPVVSDENL 292 Q9C717 YSHGSGSQKK-PRL--DR--H-------------------------------- 283
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0045616 | regulation of keratinocyte differentiation |
| 2. P | GO:0099184 | structural constituent of postsynaptic intermediate filament cytoskeleton |
| 2. P | GO:0050772 | positive regulation of axonogenesis |
| 2. P | GO:0097539 | ciliary transition fiber |
| 2. P | GO:0098831 | presynaptic active zone cytoplasmic component |
| 2. P | GO:0060050 | positive regulation of protein glycosylation |
| 2. P | GO:0072497 | mesenchymal stem cell differentiation |
| 2. P | GO:0090161 | Golgi ribbon formation |
| 2. P | GO:0005874 | microtubule |
| 2. P | GO:0045111 | intermediate filament cytoskeleton |
| 2. P | GO:0043034 | costamere |
| 2. P | GO:0045095 | keratin filament |
| 2. P | GO:0033693 | neurofilament bundle assembly |
| 2. P | GO:0048786 | presynaptic active zone |
| 2. P | GO:2000146 | negative regulation of cell motility |
| 2. P | GO:0030424 | axon |
| 2. P | GO:0045109 | intermediate filament organization |
| 2. P | GO:0034451 | centriolar satellite |
| 2. P | GO:0098882 | structural constituent of presynaptic active zone |
| 2. P | GO:1900147 | regulation of Schwann cell migration |
| 2. P | GO:0032091 | negative regulation of protein binding |
| 2. P | GO:0097449 | astrocyte projection |
| 2. P | GO:0005911 | cell-cell junction |
| 2. P | GO:0044877 | protein-containing complex binding |
| 2. P | GO:0030426 | growth cone |
| 2. P | GO:0060020 | Bergmann glial cell differentiation |
| 2. P | GO:0051707 | response to other organism |
| 2. P | GO:0007030 | Golgi organization |
| 2. P | GO:0008017 | microtubule binding |
| 2. P | GO:0045214 | sarcomere organization |
| 2. P | GO:0007020 | microtubule nucleation |
| 2. P | GO:0051645 | Golgi localization |
| 2. P | GO:0048790 | maintenance of presynaptic active zone structure |
| 2. P | GO:0120103 | centriolar subdistal appendage |
| 2. P | GO:0097191 | extrinsic apoptotic signaling pathway |
| 2. P | GO:0006888 | endoplasmic reticulum to Golgi vesicle-mediated transport |
| 2. P | GO:0140297 | DNA-binding transcription factor binding |
| 2. P | GO:0030018 | Z disc |
| 2. P | GO:0090166 | Golgi disassembly |
| 2. P | GO:0098978 | glutamatergic synapse |
| 2. P | GO:0090630 | activation of GTPase activity |
| 2. P | GO:0043000 | Golgi to plasma membrane CFTR protein transport |
| 2. P | GO:0099160 | postsynaptic intermediate filament cytoskeleton |
| 2. P | GO:0005815 | microtubule organizing center |
| 2. P | GO:0002756 | MyD88-independent toll-like receptor signaling pathway |
| 2. P | GO:0005921 | gap junction |
| 2. P | GO:0010977 | negative regulation of neuron projection development |
| 2. P | GO:0008356 | asymmetric cell division |
| 2. P | GO:0030054 | cell junction |
| 2. P | GO:0001750 | photoreceptor outer segment |
| 2. P | GO:0070062 | extracellular exosome |
| 2. P | GO:0010507 | negative regulation of autophagy |
| 2. P | GO:0014704 | intercalated disc |
| 2. P | GO:0060706 | cell differentiation involved in embryonic placenta development |
| 2. P | GO:0007098 | centrosome cycle |
| 2. P | GO:0042995 | cell projection |
| 2. P | GO:0019901 | protein kinase binding |
| 2. P | GO:0044299 | C-fiber |
| 2. P | GO:1902488 | cholangiocyte apoptotic process |
| 2. P | GO:0000922 | spindle pole |
| 2. P | GO:0045104 | intermediate filament cytoskeleton organization |
| 2. P | GO:0071944 | cell periphery |
| 2. P | GO:0005883 | neurofilament |
| 2. P | GO:0043025 | neuronal cell body |
| 2. P | GO:0005198 | structural molecule activity |
| 2. P | GO:0048167 | regulation of synaptic plasticity |
| 2. P | GO:0042383 | sarcolemma |
| 2. P | GO:0042622 | photoreceptor outer segment membrane |
| 2. P | GO:0010457 | centriole-centriole cohesion |
| 2. P | GO:0008104 | protein localization |
| 2. P | GO:0001520 | outer dense fiber |
| 2. P | GO:0036464 | cytoplasmic ribonucleoprotein granule |
| 2. P | GO:0030165 | PDZ domain binding |
| 2. P | GO:0090306 | meiotic spindle assembly |
| 2. P | GO:0097386 | glial cell projection |
| 2. P | GO:0045098 | type III intermediate filament |
| 2. P | GO:0005880 | nuclear microtubule |
| 2. P | GO:0070779 | D-aspartate import across plasma membrane |
| 2. P | GO:0030280 | structural constituent of skin epidermis |
| 2. P | GO:0031234 | extrinsic component of cytoplasmic side of plasma membrane |
| 2. P | GO:0007130 | synaptonemal complex assembly |
| 2. P | GO:0005856 | cytoskeleton |
| 2. P | GO:0061676 | importin-alpha family protein binding |
| 2. P | GO:0010269 | response to selenium ion |
| 2. P | GO:0043195 | terminal bouton |
| 2. P | GO:0044297 | cell body |
| 2. P | GO:0060252 | positive regulation of glial cell proliferation |
| 2. P | GO:0098574 | cytoplasmic side of lysosomal membrane |
| 2. P | GO:0042734 | presynaptic membrane |
| 2. P | GO:0032580 | Golgi cisterna membrane |
| 2. P | GO:0071222 | cellular response to lipopolysaccharide |
| 2. P | GO:0097110 | scaffold protein binding |
| 2. P | GO:0043292 | contractile fiber |
| 2. P | GO:0007535 | donor selection |
| 2. P | GO:0051225 | spindle assembly |
| 2. P | GO:0010564 | regulation of cell cycle process |
| 2. P | GO:0071225 | cellular response to muramyl dipeptide |
| 2. P | GO:0016010 | dystrophin-associated glycoprotein complex |
| 2. P | GO:1990830 | cellular response to leukemia inhibitory factor |
| 2. P | GO:0034142 | toll-like receptor 4 signaling pathway |
| 2. P | GO:0060291 | long-term synaptic potentiation |
| 2. P | GO:0030500 | regulation of bone mineralization |
| 2. P | GO:0000904 | cell morphogenesis involved in differentiation |
| 2. P | GO:0014002 | astrocyte development |
| 2. P | GO:0031674 | I band |
| 2. P | GO:0035024 | negative regulation of Rho protein signal transduction |
| 2. P | GO:0016363 | nuclear matrix |
| 2. P | GO:0043209 | myelin sheath |
| 2. P | GO:0010625 | positive regulation of Schwann cell proliferation |
| 2. P | GO:0072686 | mitotic spindle |
| 2. P | GO:0033209 | tumor necrosis factor-mediated signaling pathway |
| 2. P | GO:0030134 | COPII-coated ER to Golgi transport vesicle |
| 2. P | GO:0006486 | protein glycosylation |
| 2. P | GO:0097450 | astrocyte end-foot |
| 2. P | GO:0098641 | cadherin binding involved in cell-cell adhesion |
| 2. P | GO:0008385 | IkappaB kinase complex |
| 2. P | GO:0097512 | cardiac myofibril |
| 2. P | GO:0036064 | ciliary basal body |
| 2. P | GO:0008092 | cytoskeletal protein binding |
| 2. P | GO:0098685 | Schaffer collateral - CA1 synapse |
| 2. P | GO:0000445 | THO complex part of transcription export complex |
| 2. P | GO:0007010 | cytoskeleton organization |
| 2. P | GO:0090307 | mitotic spindle assembly |
| 2. P | GO:0043204 | perikaryon |
| 2. P | GO:0033116 | endoplasmic reticulum-Golgi intermediate compartment membrane |
| 2. P | GO:0051580 | regulation of neurotransmitter uptake |
| 2. P | GO:1990498 | mitotic spindle microtubule |
| 2. P | GO:0009750 | response to fructose |
| 2. P | GO:0031594 | neuromuscular junction |
| 2. P | GO:0010467 | gene expression |
| 2. P | GO:0098794 | postsynapse |
| 2. P | GO:0051289 | protein homotetramerization |
| 2. P | GO:0051599 | response to hydrostatic pressure |
| 2. P | GO:0034454 | microtubule anchoring at centrosome |
| 2. P | GO:0030154 | cell differentiation |
| 2. P | GO:0005814 | centriole |
| 2. P | GO:0016327 | apicolateral plasma membrane |
| 2. P | GO:0005200 | structural constituent of cytoskeleton |
| 2. P | GO:0016082 | synaptic vesicle priming |
| 2. P | GO:1903445 | protein transport from ciliary membrane to plasma membrane |
| 2. P | GO:0005798 | Golgi-associated vesicle |
| 2. P | GO:0098982 | GABA-ergic synapse |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:0031267 | small GTPase binding |
| 2. P | GO:0045107 | intermediate filament polymerization |
| 2. P | GO:0007252 | I-kappaB phosphorylation |
| 2. P | GO:0099635 | voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels |
| 2. P | GO:0019900 | kinase binding |
| 2. P | GO:0031102 | neuron projection regeneration |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0032991 | protein-containing complex |
| 2. P | GO:0097284 | hepatocyte apoptotic process |
| 2. P | GO:0045103 | intermediate filament-based process |
| 2. P | GO:0098973 | structural constituent of postsynaptic actin cytoskeleton |
| 2. P | GO:0000795 | synaptonemal complex |
| 2. P | GO:0070652 | HAUS complex |
| 2. P | GO:0014069 | postsynaptic density |
| 2. P | GO:1904714 | regulation of chaperone-mediated autophagy |
| 2. P | GO:0000137 | Golgi cis cisterna |
| 2. P | GO:0005882 | intermediate filament |
| 2. P | GO:0005801 | cis-Golgi network |
| 2. P | GO:0007274 | neuromuscular synaptic transmission |
| 2. P | GO:0035556 | intracellular signal transduction |
| 2. P | GO:0005916 | fascia adherens |
| 2. P | GO:0019905 | syntaxin binding |
| 2. P | GO:0031667 | response to nutrient levels |
| 2. P | GO:0060052 | neurofilament cytoskeleton organization |
| 2. P | GO:0070307 | lens fiber cell development |
| 2. P | GO:0070365 | hepatocyte differentiation |
| 2. P | GO:0042802 | identical protein binding |
| 2. P | GO:0048788 | cytoskeleton of presynaptic active zone |
| 2. P | GO:1990254 | keratin filament binding |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P0DO97 | Coiled-coil domain-containing protein 192 | 0 | 1.33e-123 | 0.0 |
| 2. P | Q5U465 | Coiled-coil domain-containing protein 125 | 3.39e-05 | 8.19e-04 | NA |
| 2. P | Q9NUQ3 | Gamma-taxilin | 3.39e-07 | 1.55e-04 | NA |
| 2. P | Q9H1L0 | Uncharacterized protein MIR1-1HG | 2.12e-02 | 2.07e-02 | NA |
| 2. P | Q6IFX4 | Keratin, type I cytoskeletal 39 | 9.37e-07 | 2.58e-04 | NA |
| 2. P | P48676 | Peripherin | 1.51e-05 | 1.11e-04 | NA |
| 2. P | Q08379 | Golgin subfamily A member 2 | 3.01e-03 | 3.94e-04 | NA |
| 2. P | Q99M74 | Keratin, type II cuticular Hb2 | 1.82e-06 | 1.83e-02 | NA |
| 2. P | P17661 | Desmin | 2.39e-06 | 2.87e-03 | NA |
| 2. P | Q7Z3Y9 | Keratin, type I cytoskeletal 26 | 4.27e-06 | 6.07e-04 | NA |
| 2. P | Q9P7J4 | THO complex subunit mft1 | 4.56e-06 | 2.03e-05 | NA |
| 2. P | P48675 | Desmin | 6.02e-06 | 4.99e-04 | NA |
| 2. P | Q5EB94 | Myocardial zonula adherens protein | 9.14e-05 | 1.46e-07 | NA |
| 2. P | P24790 | Vimentin-4 | 1.02e-04 | 2.17e-03 | NA |
| 2. P | Q5D525 | Synaptonemal complex central element protein 1-like | 1.90e-07 | 3.71e-02 | NA |
| 2. P | Q3UIJ9 | Myocardial zonula adherens protein | 5.89e-06 | 1.80e-08 | NA |
| 2. P | Q5BJY9 | Keratin, type I cytoskeletal 18 | 2.77e-07 | 2.26e-02 | NA |
| 2. P | Q5K2P2 | Keratin, type I cytoskeletal 15 (Fragment) | 7.43e-08 | 1.53e-02 | NA |
| 2. P | Q6A163 | Keratin, type I cytoskeletal 39 | 2.59e-05 | 1.69e-03 | NA |
| 2. P | P40214 | Protein FDO1 | 1.98e-05 | 2.56e-03 | NA |
| 2. P | P02541 | Desmin | 2.76e-07 | 9.47e-04 | NA |
| 2. P | Q148H7 | Keratin, type II cytoskeletal 79 | 4.20e-06 | 4.19e-02 | NA |
| 2. P | A3KN27 | Keratin, type II cytoskeletal 74 | 4.98e-06 | 7.07e-03 | NA |
| 2. P | P23729 | Type III intermediate filament | 1.51e-06 | 2.24e-04 | NA |
| 2. P | Q5BJF6 | Outer dense fiber protein 2 | 5.15e-04 | 2.20e-02 | NA |
| 2. P | Q6PH08 | ERC protein 2 | 6.44e-04 | 4.20e-03 | NA |
| 2. P | P48673 | Vimentin beta | 2.39e-05 | 3.37e-04 | NA |
| 2. P | Q6IFW3 | Keratin, type I cytoskeletal 39 | 9.13e-07 | 7.81e-04 | NA |
| 2. P | P48670 | Vimentin (Fragment) | 2.94e-08 | 5.42e-05 | NA |
| 2. P | P47819 | Glial fibrillary acidic protein | 1.21e-04 | 1.38e-02 | NA |
| 2. P | B4YNF1 | Uncharacterized protein V11 | NA | 4.64e-03 | NA |
| 2. P | P08729 | Keratin, type II cytoskeletal 7 | 9.24e-07 | 2.89e-02 | NA |
| 2. P | Q9D9F8 | Mirror-image polydactyly gene 1 protein homolog | 1.26e-07 | 5.22e-07 | NA |
| 2. P | P31393 | Plasticin | 8.52e-06 | 4.62e-04 | NA |
| 2. P | P11679 | Keratin, type II cytoskeletal 8 | 7.06e-06 | 8.25e-03 | NA |
| 2. P | Q96KP6 | TNFAIP3-interacting protein 3 | 8.90e-07 | 2.36e-03 | NA |
| 2. P | Q148H6 | Keratin, type I cytoskeletal 28 | 4.22e-06 | 9.54e-03 | NA |
| 2. P | Q62839 | Golgin subfamily A member 2 | 5.06e-04 | 2.24e-04 | NA |
| 2. P | O15083 | ERC protein 2 | 1.00e-03 | 1.31e-02 | NA |
| 2. P | P15331 | Peripherin | 1.21e-06 | 2.47e-02 | NA |
| 2. P | Q6IME9 | Keratin, type II cytoskeletal 72 | 3.18e-05 | 3.09e-02 | NA |
| 2. P | Q9UJT2 | Testis-specific serine kinase substrate | 1.51e-05 | 4.89e-02 | NA |
| 2. P | Q0VCF3 | Suppressor of IKBKE 1 | 1.33e-07 | 8.11e-04 | NA |
| 2. P | O62654 | Desmin | 9.74e-07 | 3.15e-03 | NA |
| 2. P | Q9C717 | Protein FLX-like 3 | 1.93e-09 | 5.29e-04 | NA |
| 2. P | Q6IG03 | Keratin, type II cytoskeletal 73 | 3.59e-06 | 5.53e-03 | NA |
| 2. P | Q09350 | Uncharacterized protein T09B9.4 | 8.12e-06 | 1.69e-02 | NA |
| 2. P | Q58EE9 | Glial fibrillary acidic protein | 4.87e-06 | 6.82e-04 | NA |
| 2. P | P08552 | Neurofilament medium polypeptide (Fragment) | 1.02e-07 | 6.95e-04 | NA |
| 2. P | Q8AVR2 | FGFR1 oncogene partner 2 homolog | 2.22e-07 | 1.22e-02 | NA |
| 2. P | P24789 | Vimentin-1/2 | 2.28e-05 | 2.55e-04 | NA |
| 2. P | Q8BHN1 | Gamma-taxilin | 4.59e-08 | 2.07e-02 | NA |
| 2. P | Q7ZTS4 | Keratin, type I cytoskeletal 18 | 3.21e-07 | 3.93e-03 | NA |
| 2. P | Q8L7S4 | Microtubule-associated protein 70-2 | 1.55e-04 | 5.33e-03 | NA |
| 2. P | A9UM82 | Myocardial zonula adherens protein | 5.64e-07 | 7.96e-04 | NA |
| 2. P | Q16352 | Alpha-internexin | 5.00e-08 | 2.70e-06 | NA |
| 2. P | Q5K2N9 | Keratin, type I cytoskeletal 18 | 5.56e-07 | 1.51e-03 | NA |
| 2. P | P02540 | Desmin | 1.48e-07 | 4.56e-03 | NA |
| 2. P | Q5BK57 | HAUS augmin-like complex subunit 8 | 4.40e-07 | 3.00e-05 | NA |
| 2. P | Q8K3M6 | ERC protein 2 | 2.47e-03 | 1.51e-02 | NA |
| 2. P | Q6IG04 | Keratin, type II cytoskeletal 72 | 9.76e-06 | 1.08e-02 | NA |
| 2. P | Q8VYU6 | Golgin candidate 4 | 6.24e-05 | 1.47e-02 | NA |
| 2. P | P48674 | Vimentin | 3.06e-07 | 6.62e-04 | NA |
| 2. P | P02542 | Desmin | 3.47e-05 | 2.38e-05 | NA |
| 2. P | Q9CPR7 | Suppressor of IKBKE 1 | 1.14e-07 | 1.63e-02 | NA |
| 2. P | Q497I4 | Keratin, type I cuticular Ha5 | 2.45e-06 | 1.85e-02 | NA |
| 2. P | P31000 | Vimentin | 4.67e-05 | 4.85e-02 | NA |
| 2. P | P46660 | Alpha-internexin | 1.68e-05 | 8.40e-07 | NA |
| 2. P | P03995 | Glial fibrillary acidic protein | 1.64e-06 | 1.78e-02 | NA |
| 2. P | Q6QUW1 | Retrograde protein of 51 kDa | 6.82e-08 | 9.89e-03 | NA |
| 2. P | P35617 | Low molecular weight neuronal intermediate filament | 1.64e-06 | 5.25e-05 | NA |
| 2. P | Q75AS0 | Topoisomerase I damage affected protein 11 | 3.17e-04 | 3.90e-03 | NA |
| 2. P | P41219 | Peripherin | 1.32e-05 | 1.11e-03 | NA |
| 2. P | P05783 | Keratin, type I cytoskeletal 18 | 3.35e-07 | 3.24e-03 | NA |
| 2. P | Q8N998 | Coiled-coil domain-containing protein 89 | 1.18e-06 | 1.14e-02 | NA |
| 2. P | A0JMQ7 | Microtubule-associated tumor suppressor 1 homolog A | 4.70e-06 | 1.20e-02 | NA |
| 2. P | Q3TRJ4 | Keratin, type I cytoskeletal 26 | 2.09e-05 | 1.56e-03 | NA |
| 2. P | Q5K2P4 | Keratin, type I cytoskeletal 13 | 1.59e-06 | 1.09e-04 | NA |
| 2. P | A6H712 | Keratin, type I cytoskeletal 26 | 4.75e-04 | 1.56e-03 | NA |
| 2. P | Q6IFZ9 | Keratin, type II cytoskeletal 74 | 1.76e-06 | 1.53e-02 | NA |
| 2. P | Q08DH7 | Alpha-internexin | 3.37e-07 | 2.12e-06 | NA |
| 2. P | A7YWK3 | Keratin, type II cytoskeletal 73 | 1.13e-05 | 3.40e-02 | NA |
| 2. P | P31001 | Desmin | 5.48e-07 | 6.43e-04 | NA |
| 2. P | Q10758 | Keratin, type II cytoskeletal 8 | 1.42e-07 | 3.24e-03 | NA |
| 2. P | Q7Z3Y7 | Keratin, type I cytoskeletal 28 | 2.07e-07 | 2.99e-02 | NA |
| 2. P | Q7RTS7 | Keratin, type II cytoskeletal 74 | 1.41e-05 | 6.46e-03 | NA |
| 2. P | P23239 | Desmin | 6.27e-06 | 1.21e-04 | NA |
| 2. P | Q07427 | Keratin, type I cytoskeletal 18 | 2.22e-07 | 3.04e-02 | NA |
| 2. P | Q0VCP9 | Coiled-coil domain-containing protein 149 | 5.07e-08 | 9.04e-06 | NA |
| 2. P | Q5R561 | FGFR1 oncogene partner 2 homolog | 1.10e-07 | 3.12e-02 | NA |
| 2. P | Q811U3 | ELKS/Rab6-interacting/CAST family member 1 | 1.27e-03 | 5.14e-03 | NA |
| 2. P | Q5XFN2 | Desmin | 1.35e-07 | 4.48e-03 | NA |
| 2. P | Q14CN4 | Keratin, type II cytoskeletal 72 | 4.04e-06 | 1.65e-02 | NA |
| 2. P | P23565 | Alpha-internexin | 9.76e-07 | 1.95e-05 | NA |
| 2. P | Q9U389 | Allophagy receptor allo-1 | 6.91e-07 | 4.52e-03 | NA |
| 2. P | P05787 | Keratin, type II cytoskeletal 8 | 2.89e-07 | 1.33e-02 | NA |
| 2. P | Q99L00 | HAUS augmin-like complex subunit 8 | 1.46e-04 | 2.07e-02 | NA |
| 2. P | Q5K2P6 | Keratin, type 1 cytoskeletal 11 | 1.41e-06 | 3.40e-05 | NA |
| 2. P | P0CAP1 | Myocardial zonula adherens protein | 9.50e-05 | 1.49e-07 | NA |
| 2. P | P21807 | Peripherin | 4.95e-06 | 1.16e-02 | NA |
| 2. P | Q86Z20 | Coiled-coil domain-containing protein 125 | 4.29e-06 | 6.01e-04 | NA |
| 2. P | Q9NUD7 | Uncharacterized protein C20orf96 | 3.82e-08 | 3.98e-04 | NA |
| 2. P | Q92155 | Vimentin | 1.46e-05 | 4.86e-03 | NA |
| 2. P | Q9TSV3 | Coiled-coil alpha-helical rod protein 1 (Fragment) | 3.22e-07 | 2.76e-03 | NA |
| 2. P | Q8IYJ2 | Uncharacterized protein C10orf67, mitochondrial | 5.40e-04 | 1.11e-05 | NA |
| 2. P | P08778 | Keratin, type I cytoskeletal 47 kDa | 1.09e-07 | 7.20e-03 | NA |
| 2. P | Q5FWT9 | Suppressor of IKBKE 1 | 2.22e-07 | 9.54e-03 | NA |
| 2. P | Q6NXH9 | Keratin, type II cytoskeletal 73 | 6.80e-05 | 3.42e-03 | NA |
| 2. P | A6QQJ3 | Peripherin | 3.14e-08 | 3.44e-04 | NA |
| 2. P | Q2NL98 | Vimentin-type intermediate filament-associated coiled-coil protein | 9.30e-06 | 3.40e-02 | NA |
| 2. P | Q9BT25 | HAUS augmin-like complex subunit 8 | 1.60e-04 | 2.11e-03 | NA |
| 2. P | A1KQY9 | Keratin, type I cytoskeletal 18-A | 2.78e-08 | 1.40e-02 | NA |
| 2. P | Q17QG3 | RILP-like protein 1 | 3.68e-06 | 1.25e-03 | NA |
| 2. P | Q9H2F9 | Coiled-coil domain-containing protein 68 | 1.38e-05 | 3.35e-02 | NA |
| 2. P | P05784 | Keratin, type I cytoskeletal 18 | 3.45e-07 | 6.82e-03 | NA |
| 2. P | P08776 | Keratin, type II cytoskeletal 8 | 6.19e-06 | 3.98e-02 | NA |
| 2. P | Q921M4 | Golgin subfamily A member 2 | 1.00e-03 | 2.76e-04 | NA |
| 2. P | Q01240 | 60 kDa neurofilament protein | 8.12e-07 | 4.57e-04 | NA |
| 2. P | P09654 | Vimentin | 8.63e-08 | 8.64e-03 | NA |
| 2. P | A8MT33 | Synaptonemal complex central element protein 1-like | 8.83e-06 | 8.03e-07 | NA |
| 2. P | O76013 | Keratin, type I cuticular Ha6 | 2.22e-06 | 4.53e-04 | NA |
| 2. P | Q8BVC4 | Coiled-coil domain-containing protein 68 | 3.17e-06 | 1.04e-04 | NA |