Summary
P0DPQ6
Homolog: A0A2R8VHR8.
Function: DDIT3 upstream open reading frame protein.
Statistics
Total GO Annotation: 38
Unique PROST Go: 5
Unique BLAST Go: 2
Total Homologs: 16
Unique PROST Homologs: 14
Unique BLAST Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
A0A2R8VHR8
(DDIT3 upstream open reading frame protein) with a FATCAT P-Value: 4.23e-11 and RMSD of 0.21 angstrom. The sequence alignment identity is 94.1%.
Structural alignment shown in left. Query protein P0DPQ6 colored as red in alignment, homolog A0A2R8VHR8 colored as blue.
Query protein P0DPQ6 is also shown in right top, homolog A0A2R8VHR8 showed in right bottom. They are colored based on secondary structures.
P0DPQ6 MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT 34
A0A2R8VHR8 MLKMSGWQRQSQNNSRNLRRECSRRKCIFIHHHT 34
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0006983 | ER overload response |
| 1. PB | GO:0032689 | negative regulation of interferon-gamma production |
| 1. PB | GO:0005770 | late endosome |
| 1. PB | GO:0043522 | leucine zipper domain binding |
| 1. PB | GO:2001244 | positive regulation of intrinsic apoptotic signaling pathway |
| 1. PB | GO:1990440 | positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress |
| 1. PB | GO:0032792 | negative regulation of CREB transcription factor activity |
| 1. PB | GO:0051898 | negative regulation of protein kinase B signaling |
| 1. PB | GO:0036488 | CHOP-C/EBP complex |
| 1. PB | GO:1990617 | CHOP-ATF4 complex |
| 1. PB | GO:0032700 | negative regulation of interleukin-17 production |
| 1. PB | GO:2000016 | negative regulation of determination of dorsal identity |
| 1. PB | GO:0034976 | response to endoplasmic reticulum stress |
| 1. PB | GO:1990622 | CHOP-ATF3 complex |
| 1. PB | GO:0032713 | negative regulation of interleukin-4 production |
| 1. PB | GO:0030968 | endoplasmic reticulum unfolded protein response |
| 1. PB | GO:0007605 | sensory perception of sound |
| 1. PB | GO:0008140 | cAMP response element binding protein binding |
| 1. PB | GO:0070059 | intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress |
| 1. PB | GO:0010506 | regulation of autophagy |
| 1. PB | GO:0045599 | negative regulation of fat cell differentiation |
| 1. PB | GO:0032993 | protein-DNA complex |
| 1. PB | GO:0032757 | positive regulation of interleukin-8 production |
| 1. PB | GO:0043525 | positive regulation of neuron apoptotic process |
| 1. PB | GO:0045454 | cell redox homeostasis |
| 1. PB | GO:1903026 | negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding |
| 1. PB | GO:0006986 | response to unfolded protein |
| 1. PB | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 1. PB | GO:0034263 | positive regulation of autophagy in response to ER overload |
| 1. PB | GO:0043433 | negative regulation of DNA-binding transcription factor activity |
| 1. PB | GO:0051091 | positive regulation of DNA-binding transcription factor activity |
| 2. P | GO:0000324 | fungal-type vacuole |
| 2. P | GO:0048367 | shoot system development |
| 2. P | GO:0042788 | polysomal ribosome |
| 2. P | GO:0005186 | pheromone activity |
| 2. P | GO:0098556 | cytoplasmic side of rough endoplasmic reticulum membrane |
| 3. B | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 3. B | GO:0043065 | positive regulation of apoptotic process |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P0DPQ6 | DDIT3 upstream open reading frame protein | 0 | 1.98e-159 | 1.13e-18 |
| 1. PB | A0A2R8VHR8 | DDIT3 upstream open reading frame protein | 4.23e-11 | 1.34e-62 | 1.69e-16 |
| 2. P | Q8TGP7 | Putative uncharacterized protein YDL025W-A | 1.80e-03 | 6.83e-04 | NA |
| 2. P | Q9UI72 | Putative uncharacterized protein PRO0255 | 8.12e-05 | 5.99e-04 | NA |
| 2. P | P82298 | Hemocyanin subunit 3 (Fragment) | 1.09e-06 | 4.18e-02 | NA |
| 2. P | P0C5N5 | Putative uncharacterized protein YHR180C-B | 4.50e-06 | 3.34e-02 | NA |
| 2. P | O83910 | Uncharacterized protein TP_0940 | 4.94e-01 | 1.65e-02 | NA |
| 2. P | Q8TGM0 | Uncharacterized protein YMR272W-A | 3.65e-04 | 2.37e-05 | NA |
| 2. P | P0DPP8 | Protein YsdD | 1.56e-01 | 1.19e-02 | NA |
| 2. P | P41692 | 40S ribosomal protein S26 (Fragment) | 7.76e-01 | 3.12e-02 | NA |
| 2. P | Q8TGS5 | Uncharacterized protein YMR272W-B | 5.86e-09 | 7.06e-04 | NA |
| 2. P | P31962 | A1-specific pheromone | 8.14e-01 | 4.17e-04 | NA |
| 2. P | Q6IM87 | Small polypeptide DEVIL 14 | 4.10e-04 | 1.01e-02 | NA |
| 2. P | O28340 | Uncharacterized protein AF_1939 | 1.31e-07 | 2.59e-02 | NA |
| 2. P | Q8TGL1 | Putative uncharacterized protein YOR335W-A | 5.23e-05 | 4.48e-03 | NA |
| 2. P | Q9PS08 | Dendrotoxin A (Fragment) | 7.44e-01 | 6.47e-04 | NA |