Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q61029
(Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma) with a FATCAT P-Value: 1.05e-08 and RMSD of 4.77 angstrom. The sequence alignment identity is 91.4%.
Structural alignment shown in left. Query protein P42167 colored as red in alignment, homolog Q61029 colored as blue.
Query protein P42167 is also shown in right top, homolog Q61029 showed in right bottom. They are colored based on secondary structures.
P42167 MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTD 100 Q61029 MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSKGPPDFSSDEEREPTPVLGSG-ASVGRGRGAVGRKATKKTD 99 P42167 KPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKIELKLEKRE 200 Q61029 KPRLEDKDDLDVTELSNEELLDQLVRYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTVSSSAENTRQNGSNDSDRYSDNDEDSKIELKLEKRE 199 P42167 PLKGRAKTPVTLKQRRVEHNQSYSQAGITETEWTSGSSKGGPLQALTRESTRGSRRTPRKRVETSEHFRIDGPVISESTPIAETIMASSNESLVVNRVTG 300 Q61029 PLKGRAKTPVTLKQRRTEHNQSYSQAGVTETEWTSGSSTGGPLQALTRESTRGSRRTPRKRVETSQHFRIDGAVISESTPIAETIKASSNESLVANRLTG 299 P42167 NFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDILKEMFPYEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADV 400 Q61029 NFKHASSILPITEFSDITRRTPKKPLTRAEVGEKTEERRVDRDILKEMFPYEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYAPLADV 399 P42167 KSEKTKKGRSIPVWIKILLFVVVAVFLFLVYQAMETNQVNPFSNFLHVDPRKSN 454 Q61029 KSEKTKKRRSVPMWIKMLLFALVAVFLFLVYQAMETNQGNPFTNFLQ-DTKISN 452
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0071763 | nuclear membrane organization |
| 1. PB | GO:0005874 | microtubule |
| 1. PB | GO:0032541 | cortical endoplasmic reticulum |
| 1. PB | GO:0031616 | spindle pole centrosome |
| 1. PB | GO:0005521 | lamin binding |
| 1. PB | GO:0005819 | spindle |
| 1. PB | GO:0005640 | nuclear outer membrane |
| 1. PB | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 1. PB | GO:0048147 | negative regulation of fibroblast proliferation |
| 1. PB | GO:0031468 | nuclear membrane reassembly |
| 1. PB | GO:0010165 | response to X-ray |
| 1. PB | GO:0031965 | nuclear membrane |
| 1. PB | GO:0071363 | cellular response to growth factor stimulus |
| 1. PB | GO:0005639 | integral component of nuclear inner membrane |
| 1. PB | GO:0045296 | cadherin binding |
| 1. PB | GO:0005652 | nuclear lamina |
| 1. PB | GO:0006936 | muscle contraction |
| 1. PB | GO:0005637 | nuclear inner membrane |
| 1. PB | GO:0003779 | actin binding |
| 1. PB | GO:0046827 | positive regulation of protein export from nucleus |
| 1. PB | GO:0060828 | regulation of canonical Wnt signaling pathway |
| 1. PB | GO:0035914 | skeletal muscle cell differentiation |
| 1. PB | GO:0048487 | beta-tubulin binding |
| 1. PB | GO:0000785 | chromatin |
| 1. PB | GO:0005635 | nuclear envelope |
| 2. P | GO:0016591 | RNA polymerase II, holoenzyme |
| 2. P | GO:2000280 | regulation of root development |
| 2. P | GO:0007269 | neurotransmitter secretion |
| 2. P | GO:0030718 | germ-line stem cell population maintenance |
| 2. P | GO:0005881 | cytoplasmic microtubule |
| 2. P | GO:0007420 | brain development |
| 2. P | GO:0010088 | phloem development |
| 2. P | GO:0043005 | neuron projection |
| 2. P | GO:0006906 | vesicle fusion |
| 2. P | GO:0005641 | nuclear envelope lumen |
| 2. P | GO:0030242 | autophagy of peroxisome |
| 2. P | GO:0060250 | germ-line stem-cell niche homeostasis |
| 2. P | GO:0045806 | negative regulation of endocytosis |
| 2. P | GO:0031966 | mitochondrial membrane |
| 2. P | GO:0016081 | synaptic vesicle docking |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:0043025 | neuronal cell body |
| 2. P | GO:0048211 | Golgi vesicle docking |
| 2. P | GO:0030513 | positive regulation of BMP signaling pathway |
| 2. P | GO:0048193 | Golgi vesicle transport |
| 2. P | GO:0030182 | neuron differentiation |
| 2. P | GO:0000062 | fatty-acyl-CoA binding |
| 2. P | GO:0008017 | microtubule binding |
| 2. P | GO:0042734 | presynaptic membrane |
| 2. P | GO:0034399 | nuclear periphery |
| 2. P | GO:0017075 | syntaxin-1 binding |
| 2. P | GO:0006891 | intra-Golgi vesicle-mediated transport |
| 2. P | GO:0005654 | nucleoplasm |
| 3. B | GO:0006998 | nuclear envelope organization |
| 3. B | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway |
| 3. B | GO:0032926 | negative regulation of activin receptor signaling pathway |
| 3. B | GO:0003677 | DNA binding |
| 3. B | GO:0006997 | nucleus organization |
| 3. B | GO:0006355 | regulation of transcription, DNA-templated |
| 3. B | GO:0005179 | hormone activity |
| 3. B | GO:0005634 | nucleus |
| 3. B | GO:0030514 | negative regulation of BMP signaling pathway |
| 3. B | GO:0007517 | muscle organ development |
| 3. B | GO:0000281 | mitotic cytokinesis |
| 3. B | GO:1903053 | regulation of extracellular matrix organization |
| 3. B | GO:0031490 | chromatin DNA binding |
| 3. B | GO:1902531 | regulation of intracellular signal transduction |
| 3. B | GO:0002044 | blood vessel endothelial cell migration involved in intussusceptive angiogenesis |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q63190 | Emerin | 4.84e-03 | 4.64e-10 | 0.004 |
| 1. PB | P42167 | Lamina-associated polypeptide 2, isoforms beta/gamma | 0 | 4.09e-136 | 0.0 |
| 1. PB | P42166 | Lamina-associated polypeptide 2, isoform alpha | 1.32e-02 | 1.96e-03 | 1.08e-104 |
| 1. PB | Q62733 | Lamina-associated polypeptide 2, isoform beta | 9.00e-04 | 3.72e-91 | 0.0 |
| 1. PB | P50402 | Emerin | 6.80e-02 | 7.72e-11 | 7.01e-04 |
| 1. PB | O01971 | Emerin homolog 1 | 3.18e-01 | 1.94e-07 | 2.93e-08 |
| 1. PB | Q68G75 | LEM domain-containing protein 1 | 5.61e-02 | 8.87e-09 | 2.82e-04 |
| 1. PB | O08579 | Emerin | 4.59e-02 | 4.10e-13 | 0.002 |
| 1. PB | Q61029 | Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma | 1.05e-08 | 5.94e-97 | 0.0 |
| 2. P | Q9D9D5 | Transmembrane and coiled-coil domain-containing protein 5A | 8.01e-01 | 1.89e-02 | NA |
| 2. P | Q709R6 | LEM domain-containing protein Bocksbeutel | 3.72e-02 | 1.48e-06 | NA |
| 2. P | Q32L59 | Transmembrane and coiled-coil domain-containing protein 5B | 4.99e-01 | 2.00e-03 | NA |
| 2. P | Q502L1 | Acyl-CoA-binding domain-containing protein 5A | 1.57e-01 | 3.55e-03 | NA |
| 2. P | Q9LFB9 | Protein OCTOPUS-like | 5.91e-01 | 4.94e-02 | NA |
| 2. P | Q80U23 | Syntaphilin | 3.71e-01 | 1.33e-05 | NA |
| 2. P | P20240 | Otefin | 3.18e-02 | 2.55e-04 | NA |
| 2. P | B5DF41 | Syntaphilin | 2.04e-01 | 8.74e-06 | NA |
| 2. P | O15079 | Syntaphilin | 1.47e-01 | 1.74e-04 | NA |
| 2. P | Q5REC6 | DNA-directed RNA polymerase II subunit GRINL1A | 1.52e-01 | 1.55e-02 | NA |
| 2. P | Q9JJB1 | Transmembrane protein 191C | 8.77e-01 | 1.02e-02 | NA |
| 2. P | P34237 | Protein CASP | 8.07e-01 | 3.49e-02 | NA |
| 3. B | P01250 | Thymopoietin-2 | 7.65e-03 | NA | 1.21e-21 |
| 3. B | Q61033 | Lamina-associated polypeptide 2, isoforms alpha/zeta | 3.58e-03 | NA | 7.97e-107 |
| 3. B | Q9WU40 | Inner nuclear membrane protein Man1 | 9.13e-02 | NA | 0.002 |
| 3. B | P01249 | Thymopoietin-1 | 4.07e-05 | NA | 1.20e-21 |
| 3. B | Q14C37 | LEM domain-containing protein 1 | 1.03e-02 | NA | 1.65e-04 |
| 3. B | P01251 | Splenin | 2.93e-03 | NA | 2.24e-22 |
| 3. B | Q9Y2U8 | Inner nuclear membrane protein Man1 | 8.69e-02 | NA | 3.80e-04 |