Summary

P58400

Homolog: P0DI97.
Function: Neurexin-1-beta.

Statistics

Total GO Annotation: 288
Unique PROST Go: 117
Unique BLAST Go: 87

Total Homologs: 82
Unique PROST Homologs: 36
Unique BLAST Homologs: 24

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P0DI97 (Neurexin-1-beta) with a FATCAT P-Value: 3.33e-16 and RMSD of 4.36 angstrom. The sequence alignment identity is 98.1%.
Structural alignment shown in left. Query protein P58400 colored as red in alignment, homolog P0DI97 colored as blue. Query protein P58400 is also shown in right top, homolog P0DI97 showed in right bottom. They are colored based on secondary structures. 

  P58400 MYQRMLRCGAELGSPGGGGGGGGGGGAGGRLALLWIVPLTLSGLLGVAWGASSLGAHHIHHFHGSSKHHSVPIAIYRSPASLRGGHAGTTYIFSKGGGQI 100
  P0DI97 MYQRMLRCGADLGSP----GGGSGGGAGGRLALIWIVPLTLSGLLGVAWGASSLGAHHIHHFHGSSKHHSVPIAIYRSPASLRGGHAGTTYIFSKGGGQI 96

  P58400 TYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIE 200
  P0DI97 TYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIE 196

  P58400 RYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMT 300
  P0DI97 RYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMT 296

  P58400 TESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTTGMVV 400
  P0DI97 TESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRVGGREPYPGSAEVIRESSSTTGMVV 396

  P58400 GIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSSNKNKKNKDKEYYV 472
  P0DI97 GIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNKKNKDKEYYV 468

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:1905520 positive regulation of presynaptic active zone assembly
1. PB GO:0033010 paranodal junction
1. PB GO:0071625 vocalization behavior
1. PB GO:0097118 neuroligin clustering involved in postsynaptic membrane assembly
1. PB GO:0010739 positive regulation of protein kinase A signaling
1. PB GO:0007156 homophilic cell adhesion via plasma membrane adhesion molecules
1. PB GO:0097109 neuroligin family protein binding
1. PB GO:0097104 postsynaptic membrane assembly
1. PB GO:0030424 axon
1. PB GO:0031965 nuclear membrane
1. PB GO:0005911 cell-cell junction
1. PB GO:0097091 synaptic vesicle clustering
1. PB GO:0099054 presynapse assembly
1. PB GO:0030139 endocytic vesicle
1. PB GO:0048495 Roundabout binding
1. PB GO:0005246 calcium channel regulator activity
1. PB GO:0009986 cell surface
1. PB GO:0007268 chemical synaptic transmission
1. PB GO:0007165 signal transduction
1. PB GO:0050885 neuromuscular process controlling balance
1. PB GO:0098978 glutamatergic synapse
1. PB GO:1900020 positive regulation of protein kinase C activity
1. PB GO:0007416 synapse assembly
1. PB GO:0007157 heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
1. PB GO:0045184 establishment of protein localization
1. PB GO:0099542 trans-synaptic signaling by endocannabinoid
1. PB GO:0007612 learning
1. PB GO:0005105 type 1 fibroblast growth factor receptor binding
1. PB GO:0097120 receptor localization to synapse
1. PB GO:0035176 social behavior
1. PB GO:0099059 integral component of presynaptic active zone membrane
1. PB GO:1903078 positive regulation of protein localization to plasma membrane
1. PB GO:0098793 presynapse
1. PB GO:0030534 adult behavior
1. PB GO:0043025 neuronal cell body
1. PB GO:0033138 positive regulation of peptidyl-serine phosphorylation
1. PB GO:0097105 presynaptic membrane assembly
1. PB GO:0035418 protein localization to synapse
1. PB GO:1905606 regulation of presynapse assembly
1. PB GO:0042297 vocal learning
1. PB GO:0090129 positive regulation of synapse maturation
1. PB GO:0016339 calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
1. PB GO:2000310 regulation of NMDA receptor activity
1. PB GO:0099150 regulation of postsynaptic specialization assembly
1. PB GO:0042734 presynaptic membrane
1. PB GO:0042551 neuron maturation
1. PB GO:0097119 postsynaptic density protein 95 clustering
1. PB GO:2000300 regulation of synaptic vesicle exocytosis
1. PB GO:0007411 axon guidance
1. PB GO:0097112 gamma-aminobutyric acid receptor clustering
1. PB GO:0099560 synaptic membrane adhesion
1. PB GO:0007158 neuron cell-cell adhesion
1. PB GO:0044295 axonal growth cone
1. PB GO:0005102 signaling receptor binding
1. PB GO:0033130 acetylcholine receptor binding
1. PB GO:0048306 calcium-dependent protein binding
1. PB GO:0046847 filopodium assembly
1. PB GO:0045743 positive regulation of fibroblast growth factor receptor signaling pathway
1. PB GO:0097117 guanylate kinase-associated protein clustering
1. PB GO:0098685 Schaffer collateral - CA1 synapse
1. PB GO:0099056 integral component of presynaptic membrane
1. PB GO:0007155 cell adhesion
1. PB GO:2000463 positive regulation of excitatory postsynaptic potential
1. PB GO:0023041 neuronal signal transduction
1. PB GO:0051968 positive regulation of synaptic transmission, glutamatergic
1. PB GO:0007269 neurotransmitter secretion
1. PB GO:0090126 protein-containing complex assembly involved in synapse maturation
1. PB GO:0001525 angiogenesis
1. PB GO:0071277 cellular response to calcium ion
1. PB GO:0050839 cell adhesion molecule binding
1. PB GO:2000311 regulation of AMPA receptor activity
1. PB GO:0098982 GABA-ergic synapse
1. PB GO:0098693 regulation of synaptic vesicle cycle
1. PB GO:0051965 positive regulation of synapse assembly
1. PB GO:0021707 cerebellar granule cell differentiation
1. PB GO:0032991 protein-containing complex
1. PB GO:0097114 NMDA glutamate receptor clustering
1. PB GO:0098609 cell-cell adhesion
1. PB GO:0099151 regulation of postsynaptic density assembly
1. PB GO:2000821 regulation of grooming behavior
1. PB GO:0004888 transmembrane signaling receptor activity
1. PB GO:0031982 vesicle
1. PB GO:0051490 negative regulation of filopodium assembly
1. PB GO:0097116 gephyrin clustering involved in postsynaptic density assembly
2. P GO:0005902 microvillus
2. P GO:0044300 cerebellar mossy fiber
2. P GO:0019226 transmission of nerve impulse
2. P GO:0034333 adherens junction assembly
2. P GO:0090128 regulation of synapse maturation
2. P GO:0014033 neural crest cell differentiation
2. P GO:0002605 negative regulation of dendritic cell antigen processing and presentation
2. P GO:0098880 maintenance of postsynaptic specialization structure
2. P GO:0001819 positive regulation of cytokine production
2. P GO:0030010 establishment of cell polarity
2. P GO:0007029 endoplasmic reticulum organization
2. P GO:0050859 negative regulation of B cell receptor signaling pathway
2. P GO:0002250 adaptive immune response
2. P GO:0002266 follicular dendritic cell activation
2. P GO:0019894 kinesin binding
2. P GO:0098845 postsynaptic endosome
2. P GO:1902414 protein localization to cell junction
2. P GO:0098636 protein complex involved in cell adhesion
2. P GO:0035633 maintenance of blood-brain barrier
2. P GO:0099065 integral component of spine apparatus membrane
2. P GO:1902564 negative regulation of neutrophil activation
2. P GO:0099061 integral component of postsynaptic density membrane
2. P GO:0010770 positive regulation of cell morphogenesis involved in differentiation
2. P GO:0005737 cytoplasm
2. P GO:0043318 negative regulation of cytotoxic T cell degranulation
2. P GO:0016323 basolateral plasma membrane
2. P GO:0008037 cell recognition
2. P GO:0043031 negative regulation of macrophage activation
2. P GO:0002819 regulation of adaptive immune response
2. P GO:0033629 negative regulation of cell adhesion mediated by integrin
2. P GO:0002316 follicular B cell differentiation
2. P GO:0002313 mature B cell differentiation involved in immune response
2. P GO:0007283 spermatogenesis
2. P GO:0050777 negative regulation of immune response
2. P GO:0042988 X11-like protein binding
2. P GO:0030057 desmosome
2. P GO:0002728 negative regulation of natural killer cell cytokine production
2. P GO:0060536 cartilage morphogenesis
2. P GO:0051606 detection of stimulus
2. P GO:0005783 endoplasmic reticulum
2. P GO:0097021 lymphocyte migration into lymphoid organs
2. P GO:0005886 plasma membrane
2. P GO:0071219 cellular response to molecule of bacterial origin
2. P GO:0060348 bone development
2. P GO:0002436 immune complex clearance by monocytes and macrophages
2. P GO:0008104 protein localization
2. P GO:0030165 PDZ domain binding
2. P GO:0001814 negative regulation of antibody-dependent cellular cytotoxicity
2. P GO:0044156 host cell junction
2. P GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis
2. P GO:0019864 IgG binding
2. P GO:0060042 retina morphogenesis in camera-type eye
2. P GO:1905710 positive regulation of membrane permeability
2. P GO:0001780 neutrophil homeostasis
2. P GO:0005537 mannose binding
2. P GO:0042271 susceptibility to natural killer cell mediated cytotoxicity
2. P GO:0002865 negative regulation of acute inflammatory response to antigenic stimulus
2. P GO:0001540 amyloid-beta binding
2. P GO:0002922 positive regulation of humoral immune response
2. P GO:0007160 cell-matrix adhesion
2. P GO:0019772 low-affinity IgG receptor activity
2. P GO:0009826 unidimensional cell growth
2. P GO:0098969 neurotransmitter receptor transport to postsynaptic membrane
2. P GO:0097530 granulocyte migration
2. P GO:0098688 parallel fiber to Purkinje cell synapse
2. P GO:0050869 negative regulation of B cell activation
2. P GO:0004906 interferon-gamma receptor activity
2. P GO:0071559 response to transforming growth factor beta
2. P GO:0001889 liver development
2. P GO:0097241 hematopoietic stem cell migration to bone marrow
2. P GO:0050728 negative regulation of inflammatory response
2. P GO:0070160 tight junction
2. P GO:0033624 negative regulation of integrin activation
2. P GO:0002638 negative regulation of immunoglobulin production
2. P GO:0030134 COPII-coated ER to Golgi transport vesicle
2. P GO:0010638 positive regulation of organelle organization
2. P GO:2001199 negative regulation of dendritic cell differentiation
2. P GO:0005178 integrin binding
2. P GO:0098942 retrograde trans-synaptic signaling by trans-synaptic protein complex
2. P GO:0030425 dendrite
2. P GO:0005793 endoplasmic reticulum-Golgi intermediate compartment
2. P GO:1904783 positive regulation of NMDA glutamate receptor activity
2. P GO:0031103 axon regeneration
2. P GO:0090264 regulation of immune complex clearance by monocytes and macrophages
2. P GO:0034394 protein localization to cell surface
2. P GO:0099055 integral component of postsynaptic membrane
2. P GO:0044291 cell-cell contact zone
2. P GO:0034113 heterotypic cell-cell adhesion
2. P GO:0002318 myeloid progenitor cell differentiation
2. P GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
2. P GO:0001558 regulation of cell growth
2. P GO:0002523 leukocyte migration involved in inflammatory response
2. P GO:0042803 protein homodimerization activity
2. P GO:0016338 calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules
2. P GO:0005778 peroxisomal membrane
2. P GO:0050806 positive regulation of synaptic transmission
2. P GO:1905898 positive regulation of response to endoplasmic reticulum stress
2. P GO:0090022 regulation of neutrophil chemotaxis
2. P GO:0043220 Schmidt-Lanterman incisure
2. P GO:0001811 negative regulation of type I hypersensitivity
2. P GO:0021510 spinal cord development
2. P GO:0002924 negative regulation of humoral immune response mediated by circulating immunoglobulin
2. P GO:0045954 positive regulation of natural killer cell mediated cytotoxicity
2. P GO:0002622 regulation of B cell antigen processing and presentation
2. P GO:0007286 spermatid development
2. P GO:0016021 integral component of membrane
2. P GO:1903215 negative regulation of protein targeting to mitochondrion
2. P GO:0005923 bicellular tight junction
2. P GO:0090138 regulation of actin cytoskeleton organization by cell-cell adhesion
2. P GO:0014069 postsynaptic density
2. P GO:0099003 vesicle-mediated transport in synapse
2. P GO:1902950 regulation of dendritic spine maintenance
2. P GO:0042552 myelination
2. P GO:0002693 positive regulation of cellular extravasation
2. P GO:0098632 cell-cell adhesion mediator activity
2. P GO:0031941 filamentous actin
2. P GO:0045176 apical protein localization
3. B GO:0071666 Slit-Robo signaling complex
3. B GO:0009888 tissue development
3. B GO:0030913 paranodal junction assembly
3. B GO:0005608 laminin-3 complex
3. B GO:0002011 morphogenesis of an epithelial sheet
3. B GO:0001738 morphogenesis of a polarized epithelium
3. B GO:0006929 substrate-dependent cell migration
3. B GO:1902669 positive regulation of axon guidance
3. B GO:1905962 glutamatergic neuron differentiation
3. B GO:0072006 nephron development
3. B GO:0001737 establishment of imaginal disc-derived wing hair orientation
3. B GO:0044877 protein-containing complex binding
3. B GO:0035159 regulation of tube length, open tracheal system
3. B GO:0043256 laminin complex
3. B GO:0008038 neuron recognition
3. B GO:0016201 synaptic target inhibition
3. B GO:0060076 excitatory synapse
3. B GO:0007509 mesoderm migration involved in gastrulation
3. B GO:0048846 axon extension involved in axon guidance
3. B GO:0060134 prepulse inhibition
3. B GO:0044309 neuron spine
3. B GO:0033270 paranode region of axon
3. B GO:0048787 presynaptic active zone membrane
3. B GO:0017124 SH3 domain binding
3. B GO:0072307 regulation of metanephric nephron tubule epithelial cell differentiation
3. B GO:0098595 perivitelline space
3. B GO:0008076 voltage-gated potassium channel complex
3. B GO:0044224 juxtaparanode region of axon
3. B GO:0042995 cell projection
3. B GO:0016318 ommatidial rotation
3. B GO:0038023 signaling receptor activity
3. B GO:0048057 R3/R4 development
3. B GO:0048771 tissue remodeling
3. B GO:0061304 retinal blood vessel morphogenesis
3. B GO:0043931 ossification involved in bone maturation
3. B GO:0048813 dendrite morphogenesis
3. B GO:0071205 protein localization to juxtaparanode region of axon
3. B GO:0072137 condensed mesenchymal cell proliferation
3. B GO:0002040 sprouting angiogenesis
3. B GO:0051897 positive regulation of protein kinase B signaling
3. B GO:0050929 induction of negative chemotaxis
3. B GO:0008347 glial cell migration
3. B GO:0005614 interstitial matrix
3. B GO:0022010 central nervous system myelination
3. B GO:0021756 striatum development
3. B GO:0005509 calcium ion binding
3. B GO:0016199 axon midline choice point recognition
3. B GO:0010632 regulation of epithelial cell migration
3. B GO:0005606 laminin-1 complex
3. B GO:0048841 regulation of axon extension involved in axon guidance
3. B GO:0022011 myelination in peripheral nervous system
3. B GO:0007432 salivary gland boundary specification
3. B GO:0021794 thalamus development
3. B GO:0001736 establishment of planar polarity
3. B GO:2000274 regulation of epithelial cell migration, open tracheal system
3. B GO:0070374 positive regulation of ERK1 and ERK2 cascade
3. B GO:0045163 clustering of voltage-gated potassium channels
3. B GO:0050774 negative regulation of dendrite morphogenesis
3. B GO:0071109 superior temporal gyrus development
3. B GO:0045463 R8 cell development
3. B GO:0035385 Roundabout signaling pathway
3. B GO:0007502 digestive tract mesoderm development
3. B GO:0010629 negative regulation of gene expression
3. B GO:0007427 epithelial cell migration, open tracheal system
3. B GO:0007010 cytoskeleton organization
3. B GO:0021761 limbic system development
3. B GO:0043208 glycosphingolipid binding
3. B GO:0030673 axolemma
3. B GO:0097178 ruffle assembly
3. B GO:0060445 branching involved in salivary gland morphogenesis
3. B GO:0051963 regulation of synapse assembly
3. B GO:0019800 peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan
3. B GO:0048812 neuron projection morphogenesis
3. B GO:0002175 protein localization to paranode region of axon
3. B GO:0005604 basement membrane
3. B GO:0042067 establishment of ommatidial planar polarity
3. B GO:0021987 cerebral cortex development
3. B GO:0008078 mesodermal cell migration
3. B GO:0031175 neuron projection development
3. B GO:0044331 cell-cell adhesion mediated by cadherin
3. B GO:0050884 neuromuscular process controlling posture
3. B GO:0019227 neuronal action potential propagation
3. B GO:1903598 positive regulation of gap junction assembly
3. B GO:0045467 R7 cell development
3. B GO:0007412 axon target recognition
3. B GO:0005918 septate junction
3. B GO:0021782 glial cell development

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9P2S2 Neurexin-2 6.46e-04 6.70e-04 3.62e-132
1. PB Q9HDB5 Neurexin-3-beta 4.24e-05 2.62e-20 1.58e-115
1. PB E9Q7X7 Neurexin-2 4.09e-03 3.07e-04 3.22e-132
1. PB A1XQY3 Neurexin-3b-beta 3.58e-05 2.17e-13 1.63e-127
1. PB Q63376 Neurexin-2-beta 2.84e-09 6.72e-14 5.77e-149
1. PB Q9ULB1 Neurexin-1 1.62e-03 1.03e-02 0.0
1. PB Q63373 Neurexin-1-beta 1.33e-10 1.34e-113 0.0
1. PB A1XQY0 Neurexin-3a-beta 2.54e-06 4.11e-23 3.23e-130
1. PB D0PRN2 Neurexin-1-beta 5.64e-12 2.66e-97 0.0
1. PB D0PRN4 Neurexin-3-beta 1.73e-05 1.33e-17 7.96e-137
1. PB P0DI97 Neurexin-1-beta 3.33e-16 4.16e-117 0.0
1. PB A1XQX1 Neurexin-1a-beta 2.80e-08 8.86e-66 0.0
1. PB A1XQX3 Neurexin-1b-beta 6.66e-07 2.41e-58 2.94e-157
1. PB Q9Y4C0 Neurexin-3 1.05e-02 1.31e-03 1.10e-88
1. PB Q28142 Neurexin-1-beta 2.71e-13 1.96e-115 0.0
1. PB Q8C985 Neurexin-3-beta 1.08e-06 1.13e-36 4.09e-136
1. PB Q28143 Neurexin-3-beta 1.43e-08 6.62e-78 0.0
1. PB P58401 Neurexin-2-beta 2.80e-09 6.68e-16 8.41e-150
1. PB Q63374 Neurexin-2 2.70e-03 3.57e-04 3.61e-132
1. PB P58400 Neurexin-1-beta 0 5.25e-146 0.0
1. PB Q6P9K9 Neurexin-3 6.83e-03 9.97e-03 3.28e-107
1. PB Q07310 Neurexin-3 3.05e-03 2.99e-02 2.88e-106
2. P Q91ZV7 Plexin domain-containing protein 1 1.14e-01 3.13e-03 NA
2. P Q7ZXX1 Cell adhesion molecule 3 2.42e-01 2.77e-02 NA
2. P Q6UX71 Plexin domain-containing protein 2 1.24e-01 3.07e-04 NA
2. P Q8R5M8 Cell adhesion molecule 1 3.37e-01 3.65e-02 NA
2. P Q90304 CD166 antigen homolog 3.66e-01 4.40e-02 NA
2. P Q9NT99 Leucine-rich repeat-containing protein 4B 2.51e-01 2.43e-02 NA
2. P B6KAM0 Apical membrane antigen 1 7.96e-01 4.92e-04 NA
2. P Q9H6D8 Fibronectin type III domain-containing protein 4 5.21e-01 5.90e-04 NA
2. P Q1L867 Fibronectin type III domain-containing protein 5 4.16e-01 6.03e-04 NA
2. P Q6DE92 Plexin domain-containing protein 2 1.37e-01 6.45e-05 NA
2. P A6QPL2 Fibronectin type III domain-containing protein 4 5.24e-01 1.94e-03 NA
2. P P49257 Protein ERGIC-53 3.18e-01 4.44e-02 NA
2. P Q9EPL2 Calsyntenin-1 7.93e-01 8.95e-03 NA
2. P P38484 Interferon gamma receptor 2 3.28e-01 2.31e-02 NA
2. P Q1WIM3 Cell adhesion molecule 3 2.01e-01 1.91e-02 NA
2. P Q6Q0N0 Calsyntenin-1 8.30e-01 7.72e-03 NA
2. P Q8VCD3 Protein ERGIC-53-like 6.75e-02 3.11e-02 NA
2. P Q9BY67 Cell adhesion molecule 1 1.48e-01 3.65e-02 NA
2. P Q90460 CD166 antigen homolog A 6.79e-01 1.02e-02 NA
2. P Q6AYP5 Cell adhesion molecule 1 5.10e-01 3.58e-03 NA
2. P Q04547 Envelope glycoprotein I NA 1.50e-02 NA
2. P Q60513 Low affinity immunoglobulin gamma Fc region receptor II 2.03e-01 1.91e-02 NA
2. P Q9D8B7 Junctional adhesion molecule C 2.69e-01 1.49e-02 NA
2. P P0CC10 Leucine-rich repeat-containing protein 4B 1.35e-01 4.69e-03 NA
2. P Q68FQ2 Junctional adhesion molecule C 2.84e-01 8.60e-03 NA
2. P Q3TR08 Fibronectin type III domain-containing protein 4 3.34e-01 2.19e-03 NA
2. P Q8N126 Cell adhesion molecule 3 1.98e-01 8.52e-03 NA
2. P Q9BX67 Junctional adhesion molecule C 2.39e-01 6.59e-03 NA
2. P P40200 T-cell surface protein tactile 6.86e-02 5.96e-03 NA
2. P Q8IUK5 Plexin domain-containing protein 1 4.90e-01 3.31e-04 NA
2. P Q99N28 Cell adhesion molecule 3 2.17e-01 1.70e-02 NA
2. P P31994 Low affinity immunoglobulin gamma Fc region receptor II-b 2.21e-01 2.64e-02 NA
2. P Q8NAU1 Fibronectin type III domain-containing protein 5 7.03e-01 1.77e-02 NA
2. P Q8N967 Leucine-rich repeat and transmembrane domain-containing protein 2 4.19e-01 4.48e-02 NA
2. P P0C192 Leucine-rich repeat-containing protein 4B 4.43e-01 4.69e-03 NA
2. P Q9DC11 Plexin domain-containing protein 2 3.08e-01 2.47e-04 NA
3. B Q9V5N8 Protocadherin-like wing polarity protein stan NA NA 0.006
3. B O15943 Neural-cadherin NA NA 0.043
3. B Q2PZL6 Protocadherin Fat 4 NA NA 0.042
3. B Q5RD64 Contactin-associated protein-like 2 6.65e-02 NA 5.96e-04
3. B O54991 Contactin-associated protein 1 5.52e-01 NA 5.18e-05
3. B Q9DDD0 Neurexin-1 (Fragment) 7.17e-04 NA 0.0
3. B A1XQX8 Neurexin-3a 3.89e-03 NA 4.54e-110
3. B P24014 Protein slit 3.24e-01 NA 0.013
3. B Q4VBE4 Pikachurin 3.30e-02 NA 0.018
3. B P19137 Laminin subunit alpha-1 NA NA 0.027
3. B A1XQY1 Neurexin-3b 2.35e-03 NA 4.87e-102
3. B Q28146 Neurexin-1 6.68e-03 NA 0.0
3. B A1XQX2 Neurexin-1b 1.87e-02 NA 5.51e-139
3. B Q8VHY0 Chondroitin sulfate proteoglycan 4 4.88e-01 NA 0.001
3. B D0PRN3 Neurexin-3 2.91e-03 NA 2.79e-109
3. B P78357 Contactin-associated protein 1 2.50e-01 NA 1.71e-05
3. B Q9CPW0 Contactin-associated protein-like 2 8.88e-03 NA 8.63e-04
3. B P04921 Glycophorin-C 1.44e-01 NA 0.002
3. B P97846 Contactin-associated protein 1 2.90e-02 NA 2.35e-06
3. B A1XQX0 Neurexin-1a 1.42e-03 NA 2.94e-175
3. B Q9UHC6 Contactin-associated protein-like 2 2.85e-01 NA 4.02e-04
3. B Q63372 Neurexin-1 7.37e-04 NA 0.0
3. B P49415 Syndecan 6.08e-01 NA 0.005
3. B Q9CS84 Neurexin-1 1.05e-03 NA 0.0