Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P0DI97
(Neurexin-1-beta) with a FATCAT P-Value: 3.33e-16 and RMSD of 4.36 angstrom. The sequence alignment identity is 98.1%.
Structural alignment shown in left. Query protein P58400 colored as red in alignment, homolog P0DI97 colored as blue.
Query protein P58400 is also shown in right top, homolog P0DI97 showed in right bottom. They are colored based on secondary structures.
P58400 MYQRMLRCGAELGSPGGGGGGGGGGGAGGRLALLWIVPLTLSGLLGVAWGASSLGAHHIHHFHGSSKHHSVPIAIYRSPASLRGGHAGTTYIFSKGGGQI 100 P0DI97 MYQRMLRCGADLGSP----GGGSGGGAGGRLALIWIVPLTLSGLLGVAWGASSLGAHHIHHFHGSSKHHSVPIAIYRSPASLRGGHAGTTYIFSKGGGQI 96 P58400 TYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIE 200 P0DI97 TYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIE 196 P58400 RYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMT 300 P0DI97 RYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMT 296 P58400 TESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTTGMVV 400 P0DI97 TESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRVGGREPYPGSAEVIRESSSTTGMVV 396 P58400 GIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSSNKNKKNKDKEYYV 472 P0DI97 GIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNKKNKDKEYYV 468
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:1905520 | positive regulation of presynaptic active zone assembly |
| 1. PB | GO:0033010 | paranodal junction |
| 1. PB | GO:0071625 | vocalization behavior |
| 1. PB | GO:0097118 | neuroligin clustering involved in postsynaptic membrane assembly |
| 1. PB | GO:0010739 | positive regulation of protein kinase A signaling |
| 1. PB | GO:0007156 | homophilic cell adhesion via plasma membrane adhesion molecules |
| 1. PB | GO:0097109 | neuroligin family protein binding |
| 1. PB | GO:0097104 | postsynaptic membrane assembly |
| 1. PB | GO:0030424 | axon |
| 1. PB | GO:0031965 | nuclear membrane |
| 1. PB | GO:0005911 | cell-cell junction |
| 1. PB | GO:0097091 | synaptic vesicle clustering |
| 1. PB | GO:0099054 | presynapse assembly |
| 1. PB | GO:0030139 | endocytic vesicle |
| 1. PB | GO:0048495 | Roundabout binding |
| 1. PB | GO:0005246 | calcium channel regulator activity |
| 1. PB | GO:0009986 | cell surface |
| 1. PB | GO:0007268 | chemical synaptic transmission |
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:0050885 | neuromuscular process controlling balance |
| 1. PB | GO:0098978 | glutamatergic synapse |
| 1. PB | GO:1900020 | positive regulation of protein kinase C activity |
| 1. PB | GO:0007416 | synapse assembly |
| 1. PB | GO:0007157 | heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules |
| 1. PB | GO:0045184 | establishment of protein localization |
| 1. PB | GO:0099542 | trans-synaptic signaling by endocannabinoid |
| 1. PB | GO:0007612 | learning |
| 1. PB | GO:0005105 | type 1 fibroblast growth factor receptor binding |
| 1. PB | GO:0097120 | receptor localization to synapse |
| 1. PB | GO:0035176 | social behavior |
| 1. PB | GO:0099059 | integral component of presynaptic active zone membrane |
| 1. PB | GO:1903078 | positive regulation of protein localization to plasma membrane |
| 1. PB | GO:0098793 | presynapse |
| 1. PB | GO:0030534 | adult behavior |
| 1. PB | GO:0043025 | neuronal cell body |
| 1. PB | GO:0033138 | positive regulation of peptidyl-serine phosphorylation |
| 1. PB | GO:0097105 | presynaptic membrane assembly |
| 1. PB | GO:0035418 | protein localization to synapse |
| 1. PB | GO:1905606 | regulation of presynapse assembly |
| 1. PB | GO:0042297 | vocal learning |
| 1. PB | GO:0090129 | positive regulation of synapse maturation |
| 1. PB | GO:0016339 | calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules |
| 1. PB | GO:2000310 | regulation of NMDA receptor activity |
| 1. PB | GO:0099150 | regulation of postsynaptic specialization assembly |
| 1. PB | GO:0042734 | presynaptic membrane |
| 1. PB | GO:0042551 | neuron maturation |
| 1. PB | GO:0097119 | postsynaptic density protein 95 clustering |
| 1. PB | GO:2000300 | regulation of synaptic vesicle exocytosis |
| 1. PB | GO:0007411 | axon guidance |
| 1. PB | GO:0097112 | gamma-aminobutyric acid receptor clustering |
| 1. PB | GO:0099560 | synaptic membrane adhesion |
| 1. PB | GO:0007158 | neuron cell-cell adhesion |
| 1. PB | GO:0044295 | axonal growth cone |
| 1. PB | GO:0005102 | signaling receptor binding |
| 1. PB | GO:0033130 | acetylcholine receptor binding |
| 1. PB | GO:0048306 | calcium-dependent protein binding |
| 1. PB | GO:0046847 | filopodium assembly |
| 1. PB | GO:0045743 | positive regulation of fibroblast growth factor receptor signaling pathway |
| 1. PB | GO:0097117 | guanylate kinase-associated protein clustering |
| 1. PB | GO:0098685 | Schaffer collateral - CA1 synapse |
| 1. PB | GO:0099056 | integral component of presynaptic membrane |
| 1. PB | GO:0007155 | cell adhesion |
| 1. PB | GO:2000463 | positive regulation of excitatory postsynaptic potential |
| 1. PB | GO:0023041 | neuronal signal transduction |
| 1. PB | GO:0051968 | positive regulation of synaptic transmission, glutamatergic |
| 1. PB | GO:0007269 | neurotransmitter secretion |
| 1. PB | GO:0090126 | protein-containing complex assembly involved in synapse maturation |
| 1. PB | GO:0001525 | angiogenesis |
| 1. PB | GO:0071277 | cellular response to calcium ion |
| 1. PB | GO:0050839 | cell adhesion molecule binding |
| 1. PB | GO:2000311 | regulation of AMPA receptor activity |
| 1. PB | GO:0098982 | GABA-ergic synapse |
| 1. PB | GO:0098693 | regulation of synaptic vesicle cycle |
| 1. PB | GO:0051965 | positive regulation of synapse assembly |
| 1. PB | GO:0021707 | cerebellar granule cell differentiation |
| 1. PB | GO:0032991 | protein-containing complex |
| 1. PB | GO:0097114 | NMDA glutamate receptor clustering |
| 1. PB | GO:0098609 | cell-cell adhesion |
| 1. PB | GO:0099151 | regulation of postsynaptic density assembly |
| 1. PB | GO:2000821 | regulation of grooming behavior |
| 1. PB | GO:0004888 | transmembrane signaling receptor activity |
| 1. PB | GO:0031982 | vesicle |
| 1. PB | GO:0051490 | negative regulation of filopodium assembly |
| 1. PB | GO:0097116 | gephyrin clustering involved in postsynaptic density assembly |
| 2. P | GO:0005902 | microvillus |
| 2. P | GO:0044300 | cerebellar mossy fiber |
| 2. P | GO:0019226 | transmission of nerve impulse |
| 2. P | GO:0034333 | adherens junction assembly |
| 2. P | GO:0090128 | regulation of synapse maturation |
| 2. P | GO:0014033 | neural crest cell differentiation |
| 2. P | GO:0002605 | negative regulation of dendritic cell antigen processing and presentation |
| 2. P | GO:0098880 | maintenance of postsynaptic specialization structure |
| 2. P | GO:0001819 | positive regulation of cytokine production |
| 2. P | GO:0030010 | establishment of cell polarity |
| 2. P | GO:0007029 | endoplasmic reticulum organization |
| 2. P | GO:0050859 | negative regulation of B cell receptor signaling pathway |
| 2. P | GO:0002250 | adaptive immune response |
| 2. P | GO:0002266 | follicular dendritic cell activation |
| 2. P | GO:0019894 | kinesin binding |
| 2. P | GO:0098845 | postsynaptic endosome |
| 2. P | GO:1902414 | protein localization to cell junction |
| 2. P | GO:0098636 | protein complex involved in cell adhesion |
| 2. P | GO:0035633 | maintenance of blood-brain barrier |
| 2. P | GO:0099065 | integral component of spine apparatus membrane |
| 2. P | GO:1902564 | negative regulation of neutrophil activation |
| 2. P | GO:0099061 | integral component of postsynaptic density membrane |
| 2. P | GO:0010770 | positive regulation of cell morphogenesis involved in differentiation |
| 2. P | GO:0005737 | cytoplasm |
| 2. P | GO:0043318 | negative regulation of cytotoxic T cell degranulation |
| 2. P | GO:0016323 | basolateral plasma membrane |
| 2. P | GO:0008037 | cell recognition |
| 2. P | GO:0043031 | negative regulation of macrophage activation |
| 2. P | GO:0002819 | regulation of adaptive immune response |
| 2. P | GO:0033629 | negative regulation of cell adhesion mediated by integrin |
| 2. P | GO:0002316 | follicular B cell differentiation |
| 2. P | GO:0002313 | mature B cell differentiation involved in immune response |
| 2. P | GO:0007283 | spermatogenesis |
| 2. P | GO:0050777 | negative regulation of immune response |
| 2. P | GO:0042988 | X11-like protein binding |
| 2. P | GO:0030057 | desmosome |
| 2. P | GO:0002728 | negative regulation of natural killer cell cytokine production |
| 2. P | GO:0060536 | cartilage morphogenesis |
| 2. P | GO:0051606 | detection of stimulus |
| 2. P | GO:0005783 | endoplasmic reticulum |
| 2. P | GO:0097021 | lymphocyte migration into lymphoid organs |
| 2. P | GO:0005886 | plasma membrane |
| 2. P | GO:0071219 | cellular response to molecule of bacterial origin |
| 2. P | GO:0060348 | bone development |
| 2. P | GO:0002436 | immune complex clearance by monocytes and macrophages |
| 2. P | GO:0008104 | protein localization |
| 2. P | GO:0030165 | PDZ domain binding |
| 2. P | GO:0001814 | negative regulation of antibody-dependent cellular cytotoxicity |
| 2. P | GO:0044156 | host cell junction |
| 2. P | GO:0038096 | Fc-gamma receptor signaling pathway involved in phagocytosis |
| 2. P | GO:0019864 | IgG binding |
| 2. P | GO:0060042 | retina morphogenesis in camera-type eye |
| 2. P | GO:1905710 | positive regulation of membrane permeability |
| 2. P | GO:0001780 | neutrophil homeostasis |
| 2. P | GO:0005537 | mannose binding |
| 2. P | GO:0042271 | susceptibility to natural killer cell mediated cytotoxicity |
| 2. P | GO:0002865 | negative regulation of acute inflammatory response to antigenic stimulus |
| 2. P | GO:0001540 | amyloid-beta binding |
| 2. P | GO:0002922 | positive regulation of humoral immune response |
| 2. P | GO:0007160 | cell-matrix adhesion |
| 2. P | GO:0019772 | low-affinity IgG receptor activity |
| 2. P | GO:0009826 | unidimensional cell growth |
| 2. P | GO:0098969 | neurotransmitter receptor transport to postsynaptic membrane |
| 2. P | GO:0097530 | granulocyte migration |
| 2. P | GO:0098688 | parallel fiber to Purkinje cell synapse |
| 2. P | GO:0050869 | negative regulation of B cell activation |
| 2. P | GO:0004906 | interferon-gamma receptor activity |
| 2. P | GO:0071559 | response to transforming growth factor beta |
| 2. P | GO:0001889 | liver development |
| 2. P | GO:0097241 | hematopoietic stem cell migration to bone marrow |
| 2. P | GO:0050728 | negative regulation of inflammatory response |
| 2. P | GO:0070160 | tight junction |
| 2. P | GO:0033624 | negative regulation of integrin activation |
| 2. P | GO:0002638 | negative regulation of immunoglobulin production |
| 2. P | GO:0030134 | COPII-coated ER to Golgi transport vesicle |
| 2. P | GO:0010638 | positive regulation of organelle organization |
| 2. P | GO:2001199 | negative regulation of dendritic cell differentiation |
| 2. P | GO:0005178 | integrin binding |
| 2. P | GO:0098942 | retrograde trans-synaptic signaling by trans-synaptic protein complex |
| 2. P | GO:0030425 | dendrite |
| 2. P | GO:0005793 | endoplasmic reticulum-Golgi intermediate compartment |
| 2. P | GO:1904783 | positive regulation of NMDA glutamate receptor activity |
| 2. P | GO:0031103 | axon regeneration |
| 2. P | GO:0090264 | regulation of immune complex clearance by monocytes and macrophages |
| 2. P | GO:0034394 | protein localization to cell surface |
| 2. P | GO:0099055 | integral component of postsynaptic membrane |
| 2. P | GO:0044291 | cell-cell contact zone |
| 2. P | GO:0034113 | heterotypic cell-cell adhesion |
| 2. P | GO:0002318 | myeloid progenitor cell differentiation |
| 2. P | GO:0033116 | endoplasmic reticulum-Golgi intermediate compartment membrane |
| 2. P | GO:0001558 | regulation of cell growth |
| 2. P | GO:0002523 | leukocyte migration involved in inflammatory response |
| 2. P | GO:0042803 | protein homodimerization activity |
| 2. P | GO:0016338 | calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules |
| 2. P | GO:0005778 | peroxisomal membrane |
| 2. P | GO:0050806 | positive regulation of synaptic transmission |
| 2. P | GO:1905898 | positive regulation of response to endoplasmic reticulum stress |
| 2. P | GO:0090022 | regulation of neutrophil chemotaxis |
| 2. P | GO:0043220 | Schmidt-Lanterman incisure |
| 2. P | GO:0001811 | negative regulation of type I hypersensitivity |
| 2. P | GO:0021510 | spinal cord development |
| 2. P | GO:0002924 | negative regulation of humoral immune response mediated by circulating immunoglobulin |
| 2. P | GO:0045954 | positive regulation of natural killer cell mediated cytotoxicity |
| 2. P | GO:0002622 | regulation of B cell antigen processing and presentation |
| 2. P | GO:0007286 | spermatid development |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:1903215 | negative regulation of protein targeting to mitochondrion |
| 2. P | GO:0005923 | bicellular tight junction |
| 2. P | GO:0090138 | regulation of actin cytoskeleton organization by cell-cell adhesion |
| 2. P | GO:0014069 | postsynaptic density |
| 2. P | GO:0099003 | vesicle-mediated transport in synapse |
| 2. P | GO:1902950 | regulation of dendritic spine maintenance |
| 2. P | GO:0042552 | myelination |
| 2. P | GO:0002693 | positive regulation of cellular extravasation |
| 2. P | GO:0098632 | cell-cell adhesion mediator activity |
| 2. P | GO:0031941 | filamentous actin |
| 2. P | GO:0045176 | apical protein localization |
| 3. B | GO:0071666 | Slit-Robo signaling complex |
| 3. B | GO:0009888 | tissue development |
| 3. B | GO:0030913 | paranodal junction assembly |
| 3. B | GO:0005608 | laminin-3 complex |
| 3. B | GO:0002011 | morphogenesis of an epithelial sheet |
| 3. B | GO:0001738 | morphogenesis of a polarized epithelium |
| 3. B | GO:0006929 | substrate-dependent cell migration |
| 3. B | GO:1902669 | positive regulation of axon guidance |
| 3. B | GO:1905962 | glutamatergic neuron differentiation |
| 3. B | GO:0072006 | nephron development |
| 3. B | GO:0001737 | establishment of imaginal disc-derived wing hair orientation |
| 3. B | GO:0044877 | protein-containing complex binding |
| 3. B | GO:0035159 | regulation of tube length, open tracheal system |
| 3. B | GO:0043256 | laminin complex |
| 3. B | GO:0008038 | neuron recognition |
| 3. B | GO:0016201 | synaptic target inhibition |
| 3. B | GO:0060076 | excitatory synapse |
| 3. B | GO:0007509 | mesoderm migration involved in gastrulation |
| 3. B | GO:0048846 | axon extension involved in axon guidance |
| 3. B | GO:0060134 | prepulse inhibition |
| 3. B | GO:0044309 | neuron spine |
| 3. B | GO:0033270 | paranode region of axon |
| 3. B | GO:0048787 | presynaptic active zone membrane |
| 3. B | GO:0017124 | SH3 domain binding |
| 3. B | GO:0072307 | regulation of metanephric nephron tubule epithelial cell differentiation |
| 3. B | GO:0098595 | perivitelline space |
| 3. B | GO:0008076 | voltage-gated potassium channel complex |
| 3. B | GO:0044224 | juxtaparanode region of axon |
| 3. B | GO:0042995 | cell projection |
| 3. B | GO:0016318 | ommatidial rotation |
| 3. B | GO:0038023 | signaling receptor activity |
| 3. B | GO:0048057 | R3/R4 development |
| 3. B | GO:0048771 | tissue remodeling |
| 3. B | GO:0061304 | retinal blood vessel morphogenesis |
| 3. B | GO:0043931 | ossification involved in bone maturation |
| 3. B | GO:0048813 | dendrite morphogenesis |
| 3. B | GO:0071205 | protein localization to juxtaparanode region of axon |
| 3. B | GO:0072137 | condensed mesenchymal cell proliferation |
| 3. B | GO:0002040 | sprouting angiogenesis |
| 3. B | GO:0051897 | positive regulation of protein kinase B signaling |
| 3. B | GO:0050929 | induction of negative chemotaxis |
| 3. B | GO:0008347 | glial cell migration |
| 3. B | GO:0005614 | interstitial matrix |
| 3. B | GO:0022010 | central nervous system myelination |
| 3. B | GO:0021756 | striatum development |
| 3. B | GO:0005509 | calcium ion binding |
| 3. B | GO:0016199 | axon midline choice point recognition |
| 3. B | GO:0010632 | regulation of epithelial cell migration |
| 3. B | GO:0005606 | laminin-1 complex |
| 3. B | GO:0048841 | regulation of axon extension involved in axon guidance |
| 3. B | GO:0022011 | myelination in peripheral nervous system |
| 3. B | GO:0007432 | salivary gland boundary specification |
| 3. B | GO:0021794 | thalamus development |
| 3. B | GO:0001736 | establishment of planar polarity |
| 3. B | GO:2000274 | regulation of epithelial cell migration, open tracheal system |
| 3. B | GO:0070374 | positive regulation of ERK1 and ERK2 cascade |
| 3. B | GO:0045163 | clustering of voltage-gated potassium channels |
| 3. B | GO:0050774 | negative regulation of dendrite morphogenesis |
| 3. B | GO:0071109 | superior temporal gyrus development |
| 3. B | GO:0045463 | R8 cell development |
| 3. B | GO:0035385 | Roundabout signaling pathway |
| 3. B | GO:0007502 | digestive tract mesoderm development |
| 3. B | GO:0010629 | negative regulation of gene expression |
| 3. B | GO:0007427 | epithelial cell migration, open tracheal system |
| 3. B | GO:0007010 | cytoskeleton organization |
| 3. B | GO:0021761 | limbic system development |
| 3. B | GO:0043208 | glycosphingolipid binding |
| 3. B | GO:0030673 | axolemma |
| 3. B | GO:0097178 | ruffle assembly |
| 3. B | GO:0060445 | branching involved in salivary gland morphogenesis |
| 3. B | GO:0051963 | regulation of synapse assembly |
| 3. B | GO:0019800 | peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan |
| 3. B | GO:0048812 | neuron projection morphogenesis |
| 3. B | GO:0002175 | protein localization to paranode region of axon |
| 3. B | GO:0005604 | basement membrane |
| 3. B | GO:0042067 | establishment of ommatidial planar polarity |
| 3. B | GO:0021987 | cerebral cortex development |
| 3. B | GO:0008078 | mesodermal cell migration |
| 3. B | GO:0031175 | neuron projection development |
| 3. B | GO:0044331 | cell-cell adhesion mediated by cadherin |
| 3. B | GO:0050884 | neuromuscular process controlling posture |
| 3. B | GO:0019227 | neuronal action potential propagation |
| 3. B | GO:1903598 | positive regulation of gap junction assembly |
| 3. B | GO:0045467 | R7 cell development |
| 3. B | GO:0007412 | axon target recognition |
| 3. B | GO:0005918 | septate junction |
| 3. B | GO:0021782 | glial cell development |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q9P2S2 | Neurexin-2 | 6.46e-04 | 6.70e-04 | 3.62e-132 |
| 1. PB | Q9HDB5 | Neurexin-3-beta | 4.24e-05 | 2.62e-20 | 1.58e-115 |
| 1. PB | E9Q7X7 | Neurexin-2 | 4.09e-03 | 3.07e-04 | 3.22e-132 |
| 1. PB | A1XQY3 | Neurexin-3b-beta | 3.58e-05 | 2.17e-13 | 1.63e-127 |
| 1. PB | Q63376 | Neurexin-2-beta | 2.84e-09 | 6.72e-14 | 5.77e-149 |
| 1. PB | Q9ULB1 | Neurexin-1 | 1.62e-03 | 1.03e-02 | 0.0 |
| 1. PB | Q63373 | Neurexin-1-beta | 1.33e-10 | 1.34e-113 | 0.0 |
| 1. PB | A1XQY0 | Neurexin-3a-beta | 2.54e-06 | 4.11e-23 | 3.23e-130 |
| 1. PB | D0PRN2 | Neurexin-1-beta | 5.64e-12 | 2.66e-97 | 0.0 |
| 1. PB | D0PRN4 | Neurexin-3-beta | 1.73e-05 | 1.33e-17 | 7.96e-137 |
| 1. PB | P0DI97 | Neurexin-1-beta | 3.33e-16 | 4.16e-117 | 0.0 |
| 1. PB | A1XQX1 | Neurexin-1a-beta | 2.80e-08 | 8.86e-66 | 0.0 |
| 1. PB | A1XQX3 | Neurexin-1b-beta | 6.66e-07 | 2.41e-58 | 2.94e-157 |
| 1. PB | Q9Y4C0 | Neurexin-3 | 1.05e-02 | 1.31e-03 | 1.10e-88 |
| 1. PB | Q28142 | Neurexin-1-beta | 2.71e-13 | 1.96e-115 | 0.0 |
| 1. PB | Q8C985 | Neurexin-3-beta | 1.08e-06 | 1.13e-36 | 4.09e-136 |
| 1. PB | Q28143 | Neurexin-3-beta | 1.43e-08 | 6.62e-78 | 0.0 |
| 1. PB | P58401 | Neurexin-2-beta | 2.80e-09 | 6.68e-16 | 8.41e-150 |
| 1. PB | Q63374 | Neurexin-2 | 2.70e-03 | 3.57e-04 | 3.61e-132 |
| 1. PB | P58400 | Neurexin-1-beta | 0 | 5.25e-146 | 0.0 |
| 1. PB | Q6P9K9 | Neurexin-3 | 6.83e-03 | 9.97e-03 | 3.28e-107 |
| 1. PB | Q07310 | Neurexin-3 | 3.05e-03 | 2.99e-02 | 2.88e-106 |
| 2. P | Q91ZV7 | Plexin domain-containing protein 1 | 1.14e-01 | 3.13e-03 | NA |
| 2. P | Q7ZXX1 | Cell adhesion molecule 3 | 2.42e-01 | 2.77e-02 | NA |
| 2. P | Q6UX71 | Plexin domain-containing protein 2 | 1.24e-01 | 3.07e-04 | NA |
| 2. P | Q8R5M8 | Cell adhesion molecule 1 | 3.37e-01 | 3.65e-02 | NA |
| 2. P | Q90304 | CD166 antigen homolog | 3.66e-01 | 4.40e-02 | NA |
| 2. P | Q9NT99 | Leucine-rich repeat-containing protein 4B | 2.51e-01 | 2.43e-02 | NA |
| 2. P | B6KAM0 | Apical membrane antigen 1 | 7.96e-01 | 4.92e-04 | NA |
| 2. P | Q9H6D8 | Fibronectin type III domain-containing protein 4 | 5.21e-01 | 5.90e-04 | NA |
| 2. P | Q1L867 | Fibronectin type III domain-containing protein 5 | 4.16e-01 | 6.03e-04 | NA |
| 2. P | Q6DE92 | Plexin domain-containing protein 2 | 1.37e-01 | 6.45e-05 | NA |
| 2. P | A6QPL2 | Fibronectin type III domain-containing protein 4 | 5.24e-01 | 1.94e-03 | NA |
| 2. P | P49257 | Protein ERGIC-53 | 3.18e-01 | 4.44e-02 | NA |
| 2. P | Q9EPL2 | Calsyntenin-1 | 7.93e-01 | 8.95e-03 | NA |
| 2. P | P38484 | Interferon gamma receptor 2 | 3.28e-01 | 2.31e-02 | NA |
| 2. P | Q1WIM3 | Cell adhesion molecule 3 | 2.01e-01 | 1.91e-02 | NA |
| 2. P | Q6Q0N0 | Calsyntenin-1 | 8.30e-01 | 7.72e-03 | NA |
| 2. P | Q8VCD3 | Protein ERGIC-53-like | 6.75e-02 | 3.11e-02 | NA |
| 2. P | Q9BY67 | Cell adhesion molecule 1 | 1.48e-01 | 3.65e-02 | NA |
| 2. P | Q90460 | CD166 antigen homolog A | 6.79e-01 | 1.02e-02 | NA |
| 2. P | Q6AYP5 | Cell adhesion molecule 1 | 5.10e-01 | 3.58e-03 | NA |
| 2. P | Q04547 | Envelope glycoprotein I | NA | 1.50e-02 | NA |
| 2. P | Q60513 | Low affinity immunoglobulin gamma Fc region receptor II | 2.03e-01 | 1.91e-02 | NA |
| 2. P | Q9D8B7 | Junctional adhesion molecule C | 2.69e-01 | 1.49e-02 | NA |
| 2. P | P0CC10 | Leucine-rich repeat-containing protein 4B | 1.35e-01 | 4.69e-03 | NA |
| 2. P | Q68FQ2 | Junctional adhesion molecule C | 2.84e-01 | 8.60e-03 | NA |
| 2. P | Q3TR08 | Fibronectin type III domain-containing protein 4 | 3.34e-01 | 2.19e-03 | NA |
| 2. P | Q8N126 | Cell adhesion molecule 3 | 1.98e-01 | 8.52e-03 | NA |
| 2. P | Q9BX67 | Junctional adhesion molecule C | 2.39e-01 | 6.59e-03 | NA |
| 2. P | P40200 | T-cell surface protein tactile | 6.86e-02 | 5.96e-03 | NA |
| 2. P | Q8IUK5 | Plexin domain-containing protein 1 | 4.90e-01 | 3.31e-04 | NA |
| 2. P | Q99N28 | Cell adhesion molecule 3 | 2.17e-01 | 1.70e-02 | NA |
| 2. P | P31994 | Low affinity immunoglobulin gamma Fc region receptor II-b | 2.21e-01 | 2.64e-02 | NA |
| 2. P | Q8NAU1 | Fibronectin type III domain-containing protein 5 | 7.03e-01 | 1.77e-02 | NA |
| 2. P | Q8N967 | Leucine-rich repeat and transmembrane domain-containing protein 2 | 4.19e-01 | 4.48e-02 | NA |
| 2. P | P0C192 | Leucine-rich repeat-containing protein 4B | 4.43e-01 | 4.69e-03 | NA |
| 2. P | Q9DC11 | Plexin domain-containing protein 2 | 3.08e-01 | 2.47e-04 | NA |
| 3. B | Q9V5N8 | Protocadherin-like wing polarity protein stan | NA | NA | 0.006 |
| 3. B | O15943 | Neural-cadherin | NA | NA | 0.043 |
| 3. B | Q2PZL6 | Protocadherin Fat 4 | NA | NA | 0.042 |
| 3. B | Q5RD64 | Contactin-associated protein-like 2 | 6.65e-02 | NA | 5.96e-04 |
| 3. B | O54991 | Contactin-associated protein 1 | 5.52e-01 | NA | 5.18e-05 |
| 3. B | Q9DDD0 | Neurexin-1 (Fragment) | 7.17e-04 | NA | 0.0 |
| 3. B | A1XQX8 | Neurexin-3a | 3.89e-03 | NA | 4.54e-110 |
| 3. B | P24014 | Protein slit | 3.24e-01 | NA | 0.013 |
| 3. B | Q4VBE4 | Pikachurin | 3.30e-02 | NA | 0.018 |
| 3. B | P19137 | Laminin subunit alpha-1 | NA | NA | 0.027 |
| 3. B | A1XQY1 | Neurexin-3b | 2.35e-03 | NA | 4.87e-102 |
| 3. B | Q28146 | Neurexin-1 | 6.68e-03 | NA | 0.0 |
| 3. B | A1XQX2 | Neurexin-1b | 1.87e-02 | NA | 5.51e-139 |
| 3. B | Q8VHY0 | Chondroitin sulfate proteoglycan 4 | 4.88e-01 | NA | 0.001 |
| 3. B | D0PRN3 | Neurexin-3 | 2.91e-03 | NA | 2.79e-109 |
| 3. B | P78357 | Contactin-associated protein 1 | 2.50e-01 | NA | 1.71e-05 |
| 3. B | Q9CPW0 | Contactin-associated protein-like 2 | 8.88e-03 | NA | 8.63e-04 |
| 3. B | P04921 | Glycophorin-C | 1.44e-01 | NA | 0.002 |
| 3. B | P97846 | Contactin-associated protein 1 | 2.90e-02 | NA | 2.35e-06 |
| 3. B | A1XQX0 | Neurexin-1a | 1.42e-03 | NA | 2.94e-175 |
| 3. B | Q9UHC6 | Contactin-associated protein-like 2 | 2.85e-01 | NA | 4.02e-04 |
| 3. B | Q63372 | Neurexin-1 | 7.37e-04 | NA | 0.0 |
| 3. B | P49415 | Syndecan | 6.08e-01 | NA | 0.005 |
| 3. B | Q9CS84 | Neurexin-1 | 1.05e-03 | NA | 0.0 |