Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q28142
(Neurexin-1-beta) with a FATCAT P-Value: 9.7e-11 and RMSD of 2.02 angstrom. The sequence alignment identity is 51.0%.
Structural alignment shown in left. Query protein P58401 colored as red in alignment, homolog Q28142 colored as blue.
Query protein P58401 is also shown in right top, homolog Q28142 showed in right bottom. They are colored based on secondary structures.
P58401 ------------MPPGGSGPGGCPRRPPALAGPLPPPPPPPPPPLLPLLPLLLLLLLGAAEGARVSSSLSTTHHVHHFH--SKHGTVPIAINRMPFLTRG 86 Q28142 MYQRMLRCGAELGSPGGGG-GGA-------GGRL---------ALLWIVPLTLSGLLGVAWGA---SSLG-AHHIHHFHGSSKHHSVPIAIYRSPASLRG 79 P58401 GHAGTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTR 186 Q28142 GHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTR 179 P58401 SGGNATLQVDSWPVNERYPAGNFDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVR 286 Q28142 SGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIA 279 P58401 TEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGGELILPIITEDSLD 386 Q28142 IVGNVRLVGEVPSS-MTTESTATAMQSEMSTSIMETTTTLATSTARRGNSPT-KEPVSQTTDDILVASAECPSDDEDIDPCEPSSGG------------- 364 P58401 PPPVATRSPFVPPPPTFYPFLTGVGATQDTLPPPAARRPPSGGPCQAERDDSDCEEPIEASGFASGEVFDSSLPPTDDEDFYTTFPLVTDRTTLLSPRKP 486 Q28142 ---LAN--------PT--------------------R---AGG-----R------EP------------------------Y------------------ 377 P58401 APRPNLRTDGATGAPGVLFAPSAPAPNLPAGKMNHRDPLQPLLENPPLGPGAPTSFEPRRPPPLRPGVTSAPGFPHLPTANPTGPGERGPPGAVEVIRES 586 Q28142 ------------------------------------------------------------------------------------------PGSAEVIRES 387 P58401 SSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYISNSAQSNGAVVKEKAPAAPKTPSKAKKNKDKEYYV 666 Q28142 SSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNKKNKDKEYYV 467
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:1905520 | positive regulation of presynaptic active zone assembly |
| 1. PB | GO:0071625 | vocalization behavior |
| 1. PB | GO:0097118 | neuroligin clustering involved in postsynaptic membrane assembly |
| 1. PB | GO:0010739 | positive regulation of protein kinase A signaling |
| 1. PB | GO:0097109 | neuroligin family protein binding |
| 1. PB | GO:0097104 | postsynaptic membrane assembly |
| 1. PB | GO:0031965 | nuclear membrane |
| 1. PB | GO:0097091 | synaptic vesicle clustering |
| 1. PB | GO:0099054 | presynapse assembly |
| 1. PB | GO:0030139 | endocytic vesicle |
| 1. PB | GO:0005246 | calcium channel regulator activity |
| 1. PB | GO:0007268 | chemical synaptic transmission |
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:0060134 | prepulse inhibition |
| 1. PB | GO:0098978 | glutamatergic synapse |
| 1. PB | GO:1900020 | positive regulation of protein kinase C activity |
| 1. PB | GO:0007416 | synapse assembly |
| 1. PB | GO:0045184 | establishment of protein localization |
| 1. PB | GO:0007157 | heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules |
| 1. PB | GO:0099542 | trans-synaptic signaling by endocannabinoid |
| 1. PB | GO:0007612 | learning |
| 1. PB | GO:0005105 | type 1 fibroblast growth factor receptor binding |
| 1. PB | GO:0097120 | receptor localization to synapse |
| 1. PB | GO:0035176 | social behavior |
| 1. PB | GO:0099059 | integral component of presynaptic active zone membrane |
| 1. PB | GO:1903078 | positive regulation of protein localization to plasma membrane |
| 1. PB | GO:0098793 | presynapse |
| 1. PB | GO:0030534 | adult behavior |
| 1. PB | GO:0033138 | positive regulation of peptidyl-serine phosphorylation |
| 1. PB | GO:0043025 | neuronal cell body |
| 1. PB | GO:0097105 | presynaptic membrane assembly |
| 1. PB | GO:0035418 | protein localization to synapse |
| 1. PB | GO:1905606 | regulation of presynapse assembly |
| 1. PB | GO:0042297 | vocal learning |
| 1. PB | GO:0051897 | positive regulation of protein kinase B signaling |
| 1. PB | GO:0090129 | positive regulation of synapse maturation |
| 1. PB | GO:2000310 | regulation of NMDA receptor activity |
| 1. PB | GO:0016339 | calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules |
| 1. PB | GO:0099150 | regulation of postsynaptic specialization assembly |
| 1. PB | GO:0060077 | inhibitory synapse |
| 1. PB | GO:0042734 | presynaptic membrane |
| 1. PB | GO:0042551 | neuron maturation |
| 1. PB | GO:0097119 | postsynaptic density protein 95 clustering |
| 1. PB | GO:0097112 | gamma-aminobutyric acid receptor clustering |
| 1. PB | GO:0099560 | synaptic membrane adhesion |
| 1. PB | GO:0007158 | neuron cell-cell adhesion |
| 1. PB | GO:0044295 | axonal growth cone |
| 1. PB | GO:0005102 | signaling receptor binding |
| 1. PB | GO:0033130 | acetylcholine receptor binding |
| 1. PB | GO:0048306 | calcium-dependent protein binding |
| 1. PB | GO:0046847 | filopodium assembly |
| 1. PB | GO:0070374 | positive regulation of ERK1 and ERK2 cascade |
| 1. PB | GO:0045743 | positive regulation of fibroblast growth factor receptor signaling pathway |
| 1. PB | GO:0010629 | negative regulation of gene expression |
| 1. PB | GO:0097117 | guanylate kinase-associated protein clustering |
| 1. PB | GO:0098685 | Schaffer collateral - CA1 synapse |
| 1. PB | GO:0099056 | integral component of presynaptic membrane |
| 1. PB | GO:0007155 | cell adhesion |
| 1. PB | GO:2000463 | positive regulation of excitatory postsynaptic potential |
| 1. PB | GO:0023041 | neuronal signal transduction |
| 1. PB | GO:0051968 | positive regulation of synaptic transmission, glutamatergic |
| 1. PB | GO:0007269 | neurotransmitter secretion |
| 1. PB | GO:0090126 | protein-containing complex assembly involved in synapse maturation |
| 1. PB | GO:0001525 | angiogenesis |
| 1. PB | GO:0071277 | cellular response to calcium ion |
| 1. PB | GO:0050839 | cell adhesion molecule binding |
| 1. PB | GO:2000311 | regulation of AMPA receptor activity |
| 1. PB | GO:0098982 | GABA-ergic synapse |
| 1. PB | GO:0098693 | regulation of synaptic vesicle cycle |
| 1. PB | GO:0031175 | neuron projection development |
| 1. PB | GO:0051965 | positive regulation of synapse assembly |
| 1. PB | GO:0021707 | cerebellar granule cell differentiation |
| 1. PB | GO:0032991 | protein-containing complex |
| 1. PB | GO:0097114 | NMDA glutamate receptor clustering |
| 1. PB | GO:0099151 | regulation of postsynaptic density assembly |
| 1. PB | GO:2000821 | regulation of grooming behavior |
| 1. PB | GO:0004888 | transmembrane signaling receptor activity |
| 1. PB | GO:0031982 | vesicle |
| 1. PB | GO:0051490 | negative regulation of filopodium assembly |
| 1. PB | GO:0097116 | gephyrin clustering involved in postsynaptic density assembly |
| 2. P | GO:0005737 | cytoplasm |
| 2. P | GO:0097021 | lymphocyte migration into lymphoid organs |
| 2. P | GO:0033555 | multicellular organismal response to stress |
| 2. P | GO:0021510 | spinal cord development |
| 2. P | GO:0016338 | calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules |
| 2. P | GO:0035902 | response to immobilization stress |
| 2. P | GO:0009826 | unidimensional cell growth |
| 2. P | GO:0098942 | retrograde trans-synaptic signaling by trans-synaptic protein complex |
| 2. P | GO:0098880 | maintenance of postsynaptic specialization structure |
| 2. P | GO:0060076 | excitatory synapse |
| 2. P | GO:0043235 | receptor complex |
| 2. P | GO:0030425 | dendrite |
| 2. P | GO:0045954 | positive regulation of natural killer cell mediated cytotoxicity |
| 2. P | GO:0005923 | bicellular tight junction |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:0008037 | cell recognition |
| 2. P | GO:0051606 | detection of stimulus |
| 2. P | GO:0042271 | susceptibility to natural killer cell mediated cytotoxicity |
| 3. B | GO:2000300 | regulation of synaptic vesicle exocytosis |
| 3. B | GO:0005783 | endoplasmic reticulum |
| 3. B | GO:0048771 | tissue remodeling |
| 3. B | GO:0007411 | axon guidance |
| 3. B | GO:0005509 | calcium ion binding |
| 3. B | GO:0007623 | circadian rhythm |
| 3. B | GO:0010226 | response to lithium ion |
| 3. B | GO:0097178 | ruffle assembly |
| 3. B | GO:0031258 | lamellipodium membrane |
| 3. B | GO:0044877 | protein-containing complex binding |
| 3. B | GO:0009986 | cell surface |
| 3. B | GO:0008347 | glial cell migration |
| 3. B | GO:0006929 | substrate-dependent cell migration |
| 3. B | GO:0002040 | sprouting angiogenesis |
| 3. B | GO:0050885 | neuromuscular process controlling balance |
| 3. B | GO:0042995 | cell projection |
| 3. B | GO:0016322 | neuron remodeling |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | A1XQX3 | Neurexin-1b-beta | 3.45e-04 | 1.40e-16 | 3.48e-100 |
| 1. PB | A1XQY0 | Neurexin-3a-beta | 9.31e-06 | 3.03e-52 | 0.0 |
| 1. PB | Q9HDB5 | Neurexin-3-beta | 1.28e-05 | 3.90e-49 | 0.0 |
| 1. PB | Q63376 | Neurexin-2-beta | 1.51e-07 | 2.97e-108 | 0.0 |
| 1. PB | A1XQY3 | Neurexin-3b-beta | 3.09e-05 | 3.48e-55 | 0.0 |
| 1. PB | D0PRN2 | Neurexin-1-beta | 8.09e-06 | 1.25e-14 | 3.63e-161 |
| 1. PB | D0PRN4 | Neurexin-3-beta | 1.69e-05 | 1.37e-59 | 0.0 |
| 1. PB | P0DI97 | Neurexin-1-beta | 7.98e-10 | 9.79e-16 | 2.52e-167 |
| 1. PB | Q8C985 | Neurexin-3-beta | 1.28e-05 | 1.63e-46 | 2.76e-128 |
| 1. PB | Q28142 | Neurexin-1-beta | 9.70e-11 | 4.27e-17 | 1.20e-168 |
| 1. PB | Q63373 | Neurexin-1-beta | 3.47e-08 | 1.43e-16 | 1.51e-167 |
| 1. PB | P58400 | Neurexin-1-beta | 2.80e-09 | 1.43e-14 | 1.41e-167 |
| 1. PB | Q28143 | Neurexin-3-beta | 4.28e-07 | 2.31e-17 | 1.08e-128 |
| 1. PB | P58401 | Neurexin-2-beta | 0 | 6.95e-133 | 0.0 |
| 1. PB | A1XQX1 | Neurexin-1a-beta | 1.08e-05 | 8.47e-19 | 6.09e-136 |
| 2. P | Q8IUK5 | Plexin domain-containing protein 1 | 6.51e-01 | 9.05e-03 | NA |
| 2. P | Q91ZV7 | Plexin domain-containing protein 1 | 7.96e-01 | 2.37e-03 | NA |
| 2. P | Q8CB67 | Low-density lipoprotein receptor-related protein 11 | 4.54e-01 | 2.67e-02 | NA |
| 2. P | B6K9M7 | Apical membrane antigen 1-like protein | 6.41e-01 | 2.25e-02 | NA |
| 2. P | P16445 | Apical membrane antigen 1 | 9.14e-01 | 1.48e-03 | NA |
| 2. P | P81780 | Envelope glycoprotein G | NA | 2.02e-02 | NA |
| 2. P | P21303 | Merozoite receptor PK66 | 7.34e-01 | 4.34e-04 | NA |
| 2. P | Q6AYP5 | Cell adhesion molecule 1 | 7.19e-01 | 1.22e-02 | NA |
| 2. P | P13290 | Envelope glycoprotein G | NA | 3.93e-02 | NA |
| 3. B | Q07310 | Neurexin-3 | 3.20e-03 | NA | 6.38e-105 |
| 3. B | Q28146 | Neurexin-1 | 2.61e-02 | NA | 1.41e-135 |
| 3. B | Q9P2S2 | Neurexin-2 | 4.19e-03 | NA | 0.0 |
| 3. B | Q9Y4C0 | Neurexin-3 | 2.23e-02 | NA | 0.0 |
| 3. B | E9Q7X7 | Neurexin-2 | 5.27e-02 | NA | 0.0 |
| 3. B | P04921 | Glycophorin-C | 3.60e-01 | NA | 1.77e-04 |
| 3. B | A1XQX0 | Neurexin-1a | 2.58e-02 | NA | 1.31e-120 |
| 3. B | Q9DDD0 | Neurexin-1 (Fragment) | 3.24e-02 | NA | 4.64e-131 |
| 3. B | A1XQX8 | Neurexin-3a | 1.78e-03 | NA | 0.0 |
| 3. B | A1XQX2 | Neurexin-1b | 9.25e-02 | NA | 7.17e-86 |
| 3. B | Q63374 | Neurexin-2 | 2.34e-03 | NA | 0.0 |
| 3. B | Q9ULB1 | Neurexin-1 | 3.93e-02 | NA | 1.63e-107 |
| 3. B | Q63372 | Neurexin-1 | 1.33e-02 | NA | 1.37e-134 |
| 3. B | Q9CS84 | Neurexin-1 | 1.68e-02 | NA | 2.09e-135 |
| 3. B | Q6P9K9 | Neurexin-3 | 4.48e-03 | NA | 4.67e-106 |
| 3. B | Q00657 | Chondroitin sulfate proteoglycan 4 | 8.32e-01 | NA | 0.029 |
| 3. B | A1XQY1 | Neurexin-3b | 9.15e-02 | NA | 0.0 |
| 3. B | D0PRN3 | Neurexin-3 | 1.01e-01 | NA | 0.0 |