Summary

P60896

Homolog: P60897.
Function: 26S proteasome complex subunit SEM1.

Statistics

Total GO Annotation: 45
Unique PROST Go: 22
Unique BLAST Go: 2

Total Homologs: 35
Unique PROST Homologs: 26
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P60897 (26S proteasome complex subunit SEM1) with a FATCAT P-Value: 0.0 and RMSD of 0.68 angstrom. The sequence alignment identity is 100.0%.
Structural alignment shown in left. Query protein P60896 colored as red in alignment, homolog P60897 colored as blue. Query protein P60896 is also shown in right top, homolog P60897 showed in right bottom. They are colored based on secondary structures. 

  P60896 MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS 70
  P60897 MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS 70

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0040018 positive regulation of multicellular organism growth
1. PB GO:0031398 positive regulation of protein ubiquitination
1. PB GO:0002119 nematode larval development
1. PB GO:0016578 histone deubiquitination
1. PB GO:0000724 double-strand break repair via homologous recombination
1. PB GO:0006406 mRNA export from nucleus
1. PB GO:0040025 vulval development
1. PB GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
1. PB GO:0045927 positive regulation of growth
1. PB GO:0000502 proteasome complex
1. PB GO:0050892 intestinal absorption
1. PB GO:0009792 embryo development ending in birth or egg hatching
1. PB GO:0030447 filamentous growth
1. PB GO:0043248 proteasome assembly
1. PB GO:0008541 proteasome regulatory particle, lid subcomplex
1. PB GO:0072742 SAGA complex localization to transcription regulatory region
1. PB GO:0035753 maintenance of DNA trinucleotide repeats
1. PB GO:0048477 oogenesis
1. PB GO:0060429 epithelium development
1. PB GO:0070390 transcription export complex 2
1. PB GO:0034515 proteasome storage granule
2. P GO:0000900 translation repressor activity, mRNA regulatory element binding
2. P GO:0005102 signaling receptor binding
2. P GO:0007283 spermatogenesis
2. P GO:0031386 protein tag
2. P GO:0003729 mRNA binding
2. P GO:0030534 adult behavior
2. P GO:0034728 nucleosome organization
2. P GO:0045947 negative regulation of translational initiation
2. P GO:0008180 COP9 signalosome
2. P GO:0008143 poly(A) binding
2. P GO:0034644 cellular response to UV
2. P GO:0009566 fertilization
2. P GO:0019941 modification-dependent protein catabolic process
2. P GO:0051726 regulation of cell cycle
2. P GO:0010498 proteasomal protein catabolic process
2. P GO:0017148 negative regulation of translation
2. P GO:1900271 regulation of long-term synaptic potentiation
2. P GO:2000435 negative regulation of protein neddylation
2. P GO:0070490 protein pupylation
2. P GO:0007613 memory
2. P GO:0070628 proteasome binding
2. P GO:0030371 translation repressor activity
3. B GO:0032991 protein-containing complex
3. B GO:0005634 nucleus

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9VM46 Probable 26S proteasome complex subunit sem1 7.27e-04 2.06e-25 1.68e-11
1. PB Q3ZBR6 26S proteasome complex subunit SEM1 1.62e-12 1.62e-143 8.15e-44
1. PB O94742 26S proteasome complex subunit SEM1 5.09e-02 1.89e-06 3.54e-10
1. PB Q7SA04 Putative 26S proteasome complex subunit sem-1 1.62e-02 1.58e-12 5.68e-08
1. PB P60896 26S proteasome complex subunit SEM1 0 1.62e-143 8.15e-44
1. PB P60897 26S proteasome complex subunit SEM1 0.00e+00 1.62e-143 8.15e-44
1. PB A8XLU5 Probable 26S proteasome complex subunit dss-1 2.91e-03 4.73e-29 1.01e-05
1. PB O14140 26S proteasome complex subunit rpn15 1.68e-03 1.76e-43 1.06e-04
1. PB Q95Y72 Probable 26S proteasome complex subunit dss-1 1.38e-02 8.88e-23 2.54e-07
2. P A9WSI2 Prokaryotic ubiquitin-like protein Pup 5.77e-03 2.50e-03 NA
2. P Q9BPZ3 Polyadenylate-binding protein-interacting protein 2 9.27e-02 1.14e-02 NA
2. P Q5ZJS6 Polyadenylate-binding protein-interacting protein 2 5.45e-02 1.95e-02 NA
2. P Q5H9J7 Protein BEX5 7.16e-02 6.60e-03 NA
2. P Q54K21 Probable 26S proteasome complex subunit sem1 6.84e-03 2.51e-30 NA
2. P Q9XIR8 Protein DELETION OF SUV3 SUPPRESSOR 1(I) 4.04e-03 1.30e-24 NA
2. P O31572 Uncharacterized protein YfhD 2.23e-01 3.80e-02 NA
2. P Q9FL96 Protein DSS1 HOMOLOG ON CHROMOSOME V 2.54e-03 1.73e-23 NA
2. P A0JWY5 Prokaryotic ubiquitin-like protein Pup 1.53e-03 5.19e-03 NA
2. P Q9ULR5 Polyadenylate-binding protein-interacting protein 2B 5.14e-02 4.28e-03 NA
2. P B8H8L5 Prokaryotic ubiquitin-like protein Pup 2.88e-03 2.22e-02 NA
2. P A4QE81 Prokaryotic ubiquitin-like protein Pup 2.21e-02 4.16e-02 NA
2. P Q10239 Histone H2A.Z-specific chaperone chz1 3.64e-01 5.39e-04 NA
2. P C4LIL0 Prokaryotic ubiquitin-like protein Pup 7.47e-03 8.95e-03 NA
2. P A1SK12 Prokaryotic ubiquitin-like protein Pup 9.13e-03 1.50e-02 NA
2. P A8M2A2 Prokaryotic ubiquitin-like protein Pup 4.89e-03 1.82e-02 NA
2. P Q8NQE0 Prokaryotic ubiquitin-like protein Pup 3.76e-02 4.16e-02 NA
2. P Q6AXZ0 Polyadenylate-binding protein-interacting protein 2 5.94e-02 3.11e-03 NA
2. P P70675 Testis-specific protein TSX 3.55e-01 2.64e-02 NA
2. P Q3ZC67 Polyadenylate-binding protein-interacting protein 2 1.15e-01 3.26e-03 NA
2. P P62499 Probable 26S proteasome complex subunit SEM1 2.22e-02 2.71e-18 NA
2. P Q3ZBJ9 Protein BEX5 3.69e-02 2.43e-02 NA
2. P Q9D6V8 Polyadenylate-binding protein-interacting protein 2 7.40e-02 3.11e-03 NA
2. P Q5R596 Polyadenylate-binding protein-interacting protein 2 4.88e-02 4.24e-03 NA
2. P Q54GR2 Uncharacterized protein DDB_G0289957 2.07e-02 3.02e-03 NA
2. P Q7JVR7 COP9 signalosome complex subunit 9 homolog 1.62e-01 7.76e-03 NA