Results | PROST

Summary

P61570

Homolog: P61565.
Function: Endogenous retrovirus group K member 21 Env polyprotein.

Statistics

Total GO Annotation: 46
Unique PROST Go: 25
Unique BLAST Go: 13

Total Homologs: 349
Unique PROST Homologs: 319
Unique BLAST Homologs: 15

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P61565 (Endogenous retrovirus group K member 21 Env polyprotein) with a FATCAT P-Value: 0.0 and RMSD of 3.37 angstrom. The sequence alignment identity is 92.6%.
Structural alignment shown in left. Query protein P61570 colored as red in alignment, homolog P61565 colored as blue. Query protein P61570 is also shown in right top, homolog P61565 showed in right bottom. They are colored based on secondary structures.

  P61570 MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVVSLPMPAGAAAAN 100
  P61565 MHPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTS-EQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVVSLPMPAGAAAAN 99

  P61570 YTYWAYVPFPPLIRAVTWMDNPIEVYVNDSVWVPGPIDDRCPAKPEEEGMMINISIGYRYPPICLGTAPGCLMPAVQNWLVEVPIVSPISRFTYHMVSGM 200
  P61565 YTNWAYVPFPPLIRAVTWMDNPIEVYVNDSVWVHGPIDDRCPAKPEEEGMMINISIGYHYPPICLGRAPGCLMPAVQNWLVEVPTVSPISRFTYNMVSGM 199

  P61570 SLRPRVNYLQDFSYQRSLKFRPKGKPCPKEIPKESKNTEVLVWEECVANSAVILQNNEFGTIIDWAPRGQFYHNCSGQTQSCPSAQVSPAVDSDLTESLD 300
  P61565 SLRPRVNYLQDFSYQRSLKFRPKGKPCPKEIPKESKNTEVLVWEECVANSVVILQNNEFGTIIDWAPRGQFYHNCSGQTQSCPSAQVSPAVDSDLTESLD 299

  P61570 KHKHKKLQSFYPWEWGEKGISTPRPKIVSPVSGPEHPELWRLTVASHHIRIWSGNQTLETRDRKPFYTVDLNSSLTVPLQSCVKPPYMLVVGNIVIKPDS 400
  P61565 KHKHKKLQSFYPWEWGEKGISTPRPKIISPVSGPEHPELWRLTVASHHIRIWSGNQTLETRDRKPFYTVDLNSSLTVPLQSCVKPPYMLVVGNIVIKPDS 399

  P61570 QTITCENCRLLTCIDSTFNWQHRILLVRAREGVWIPVSMDRPWEASPSIHILTEVLKGVLNRSKRFIFTLIAVIMGLIAVTATGAVAGVALHSSVQSVNF 500
  P61565 QTITCENCRLLTCIDSTFNWQHRILLVRAREGVWIPVSMDRPWEASPSIHILTEVLKGVLNRSKRFIFTLIAVIMGLIAVTAMAAVAGVALHSFVQSVNF 499

  P61570 VNDWQKNSTRLWNSQSSIDQKLANQINDLRQTVIWMGDRLMSLEHRFQLQCDWNTSDFCITPQIYNESEHHWDMVRRHLQGREDNLTLDISKLKEQIFKA 600
  P61565 VNDWQKNSTRLWNSQSSIDQKLANQINDLRQTVIWMGDRLMSLEHRFQLQCDWNTSDFCITPQIYNESEHHWDMVRRHLQGREDNLTLDISKLKEQIFEA 599

  P61570 SKAHLNLVPGTEAIAGVADGLANLNPVTWVKTIGSTTIINLILILVCLFCLLLVCRCTQQL-------------------------------------- 661
  P61565 SKAHLNLVPGTEAIAGVADGLANLNPVTWVKTIGSTTIINLILILVCLFCLLLVCRCTQQLRRDSDHRERAMMTMVVLSKRKGGNVGKSKRDQIVTVSV 698

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0005198	structural molecule activity
1. PB	GO:0019064	fusion of virus membrane with host plasma membrane
1. PB	GO:0019031	viral envelope
1. PB	GO:0019062	virion attachment to host cell
1. PB	GO:0016021	integral component of membrane
1. PB	GO:0098670	entry receptor-mediated virion attachment to host cell
1. PB	GO:0055036	virion membrane
1. PB	GO:0020002	host cell plasma membrane
2. P	GO:0039663	membrane fusion involved in viral entry into host cell
2. P	GO:0046718	viral entry into host cell
2. P	GO:0044175	host cell endosome membrane
2. P	GO:0046813	receptor-mediated virion attachment to host cell
2. P	GO:0075509	endocytosis involved in viral entry into host cell
2. P	GO:0039588	suppression by virus of host antigen processing and presentation
2. P	GO:0039587	suppression by virus of host tetherin activity
2. P	GO:0044167	host cell endoplasmic reticulum membrane
2. P	GO:0046789	host cell surface receptor binding
2. P	GO:0039504	suppression by virus of host adaptive immune response
2. P	GO:0019048	modulation by virus of host process
2. P	GO:0006949	syncytium formation
2. P	GO:0106330	sialate 9-O-acetylesterase activity
2. P	GO:0039654	fusion of virus membrane with host endosome membrane
2. P	GO:0000768	syncytium formation by plasma membrane fusion
2. P	GO:0030666	endocytic vesicle membrane
2. P	GO:0039502	suppression by virus of host type I interferon-mediated signaling pathway
2. P	GO:0106331	sialate 4-O-acetylesterase activity
2. P	GO:0075512	clathrin-dependent endocytosis of virus by host cell
2. P	GO:0007520	myoblast fusion
2. P	GO:0046872	metal ion binding
2. P	GO:0005576	extracellular region
2. P	GO:0046761	viral budding from plasma membrane
2. P	GO:0019065	receptor-mediated endocytosis of virus by host cell
2. P	GO:0044173	host cell endoplasmic reticulum-Golgi intermediate compartment membrane
3. B	GO:0003723	RNA binding
3. B	GO:0005886	plasma membrane
3. B	GO:0016032	viral process
3. B	GO:0004523	RNA-DNA hybrid ribonuclease activity
3. B	GO:0006406	mRNA export from nucleus
3. B	GO:0003964	RNA-directed DNA polymerase activity
3. B	GO:0051028	mRNA transport
3. B	GO:0035613	RNA stem-loop binding
3. B	GO:0002218	activation of innate immune response
3. B	GO:0035458	cellular response to interferon-beta
3. B	GO:0005730	nucleolus
3. B	GO:0006310	DNA recombination
3. B	GO:0015074	DNA integration

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	O71037	Endogenous retrovirus group K member 19 Env polyprotein	0.00e+00	1.12e-62	0.0
1. PB	Q85646	Envelope glycoprotein gp70	NA	2.28e-42	6.37e-33
1. PB	Q902F8	Endogenous retrovirus group K member 8 Env polyprotein	0.00e+00	5.35e-64	0.0
1. PB	P03374	Envelope glycoprotein gp70	NA	3.05e-44	1.08e-33
1. PB	P61566	Endogenous retrovirus group K member 24 Env polyprotein	5.97e-14	2.64e-08	0.0
1. PB	Q69384	Endogenous retrovirus group K member 6 Env polyprotein	0.00e+00	9.83e-63	0.0
1. PB	P61565	Endogenous retrovirus group K member 21 Env polyprotein	0.00e+00	2.87e-59	0.0
1. PB	Q902F9	Endogenous retrovirus group K member 113 Env polyprotein	0.00e+00	8.27e-60	0.0
1. PB	P31621	Envelope glycoprotein	NA	2.10e-27	9.03e-36
1. PB	P10259	Envelope glycoprotein gp70	NA	1.41e-42	6.83e-34
1. PB	Q9NX77	Endogenous retrovirus group K member 13-1 Env polyprotein	1.22e-06	9.31e-10	3.87e-152
1. PB	Q9UKH3	Endogenous retrovirus group K member 9 Env polyprotein	0.00e+00	3.68e-60	0.0
1. PB	O42043	Endogenous retrovirus group K member 18 Env polyprotein	0.00e+00	1.13e-25	0.0
1. PB	P61567	Endogenous retrovirus group K member 7 Env polyprotein	0.00e+00	2.69e-07	0.0
1. PB	P61570	Endogenous retrovirus group K member 25 Env polyprotein	0	3.05e-157	0.0
2. P	P16060	Hemagglutinin	NA	1.60e-06	NA
2. P	P26094	Hemagglutinin	NA	2.13e-12	NA
2. P	P26139	Hemagglutinin	NA	5.21e-09	NA
2. P	P06752	Envelope glycoprotein	NA	2.82e-26	NA
2. P	Q03817	Envelope glycoprotein gp62	NA	2.28e-17	NA
2. P	Q3LZX1	Spike glycoprotein	NA	2.79e-06	NA
2. P	Q67143	Hemagglutinin	NA	1.39e-05	NA
2. P	P03439	Hemagglutinin	NA	1.54e-07	NA
2. P	P87691	Hemagglutinin-esterase-fusion glycoprotein	NA	8.93e-16	NA
2. P	P26140	Hemagglutinin	NA	3.31e-05	NA
2. P	P17002	Hemagglutinin	NA	8.50e-07	NA
2. P	P07966	Hemagglutinin-esterase-fusion glycoprotein (Fragment)	NA	9.03e-12	NA
2. P	P19694	Hemagglutinin	NA	2.72e-07	NA
2. P	P14075	Envelope glycoprotein gp62	NA	5.80e-17	NA
2. P	P03443	Hemagglutinin	NA	4.69e-08	NA
2. P	Q9WCD8	Hemagglutinin	NA	4.16e-05	NA
2. P	P26095	Hemagglutinin	NA	5.92e-14	NA
2. P	Q3I5J5	Spike glycoprotein	NA	1.44e-05	NA
2. P	P03397	Envelope glycoprotein gp95	NA	3.82e-21	NA
2. P	Q80A22	Hemagglutinin (Fragment)	NA	1.04e-07	NA
2. P	Q2F7J1	Envelope glycoprotein	NA	3.83e-24	NA
2. P	Q91AV1	Spike glycoprotein	NA	1.03e-02	NA
2. P	Q9WCE8	Hemagglutinin	NA	4.15e-07	NA
2. P	P16994	Hemagglutinin	NA	6.30e-07	NA
2. P	P07970	Hemagglutinin-esterase-fusion glycoprotein (Fragment)	NA	5.29e-16	NA
2. P	P35954	Envelope glycoprotein gp160	NA	2.64e-08	NA
2. P	P18875	Hemagglutinin	NA	3.05e-06	NA
2. P	Q82559	Hemagglutinin	NA	3.54e-07	NA
2. P	P21436	Envelope glycoprotein	NA	5.11e-22	NA
2. P	P16997	Hemagglutinin	NA	4.67e-07	NA
2. P	P31794	Envelope glycoprotein	NA	2.69e-21	NA
2. P	P61562	Syncytin-1	2.16e-01	5.86e-04	NA
2. P	P61552	ERV-BabFcenv provirus ancestral Env polyprotein	2.19e-01	4.19e-19	NA
2. P	Q9UQF0	Syncytin-1	3.49e-01	3.69e-04	NA
2. P	P12585	Hemagglutinin (Fragment)	NA	3.99e-03	NA
2. P	P07974	Hemagglutinin-esterase-fusion glycoprotein (Fragment)	NA	8.10e-18	NA
2. P	Q6DQ19	Hemagglutinin (Fragment)	NA	2.23e-07	NA
2. P	P07971	Hemagglutinin-esterase-fusion glycoprotein (Fragment)	NA	3.05e-13	NA
2. P	Q7T9D9	Envelope glycoprotein	NA	2.36e-03	NA
2. P	P11134	Hemagglutinin (Fragment)	NA	3.41e-04	NA
2. P	P09767	Hemagglutinin (Fragment)	NA	1.52e-06	NA
2. P	Q0Q4F2	Spike glycoprotein	NA	4.53e-03	NA
2. P	P11133	Hemagglutinin (Fragment)	NA	5.59e-03	NA
2. P	P17001	Hemagglutinin	NA	8.95e-07	NA
2. P	P03381	Envelope glycoprotein gp62	NA	1.16e-16	NA
2. P	P03435	Hemagglutinin	NA	3.07e-08	NA
2. P	P61564	Syncytin-1	3.73e-01	3.11e-04	NA
2. P	P03437	Hemagglutinin	NA	2.87e-07	NA
2. P	P26096	Hemagglutinin	NA	5.47e-13	NA
2. P	P25057	Envelope glycoprotein	NA	4.34e-02	NA
2. P	P27977	Envelope glycoprotein gp160	NA	4.34e-02	NA
2. P	O11457	Envelope glycoprotein	NA	8.32e-03	NA
2. P	Q87041	Envelope glycoprotein gp130	NA	6.62e-04	NA
2. P	P07968	Hemagglutinin-esterase-fusion glycoprotein (Fragment)	NA	1.16e-12	NA
2. P	P07575	Envelope glycoprotein	NA	2.45e-16	NA
2. P	Q80A26	Hemagglutinin (Fragment)	NA	6.55e-07	NA
2. P	P43259	Hemagglutinin (Fragment)	NA	6.01e-05	NA
2. P	Q9Q0U6	Hemagglutinin	NA	2.82e-08	NA
2. P	A4K143	Hemagglutinin	NA	1.69e-08	NA
2. P	Q80A28	Hemagglutinin (Fragment)	NA	3.01e-05	NA
2. P	O10236	Glycoprotein	NA	4.20e-03	NA
2. P	P12584	Hemagglutinin (Fragment)	NA	6.19e-04	NA
2. P	P19557	Envelope glycoprotein	NA	1.67e-02	NA
2. P	P43260	Hemagglutinin (Fragment)	NA	7.00e-05	NA
2. P	P27757	Envelope glycoprotein gp160	NA	7.12e-16	NA
2. P	P09345	Hemagglutinin	NA	1.86e-04	NA
2. P	P03383	Envelope glycoprotein gp63	NA	3.55e-15	NA
2. P	O56861	Envelope glycoprotein gp130	NA	2.90e-06	NA
2. P	P26137	Hemagglutinin (Fragment)	NA	6.99e-07	NA
2. P	P10269	Envelope glycoprotein	NA	8.56e-25	NA
2. P	P87671	Envelope glycoprotein	NA	1.07e-02	NA
2. P	P61558	Syncytin-2	3.38e-01	4.71e-26	NA
2. P	P19702	Hemagglutinin	NA	1.71e-09	NA
2. P	P03386	Envelope glycoprotein	NA	1.46e-23	NA
2. P	Q03804	Envelope glycoprotein gp150	NA	1.55e-23	NA
2. P	Q9WFX3	Hemagglutinin	NA	7.34e-08	NA
2. P	P16996	Hemagglutinin	NA	1.07e-06	NA
2. P	Q0A448	Hemagglutinin	NA	2.09e-16	NA
2. P	P61550	Endogenous retrovirus group S71 member 1 Env polyprotein	3.15e-01	7.09e-27	NA
2. P	P03448	Hemagglutinin	NA	2.30e-08	NA
2. P	P31626	Envelope glycoprotein	NA	3.98e-09	NA
2. P	P14351	Envelope glycoprotein gp130	NA	1.99e-03	NA
2. P	A4GCI6	Hemagglutinin	NA	7.85e-09	NA
2. P	Q6Q1S2	Spike glycoprotein	NA	3.55e-03	NA
2. P	P03389	Glycoprotein 55	NA	9.54e-07	NA
2. P	B6SEH9	Endogenous retrovirus group V member 2 Env polyprotein	4.69e-01	1.15e-05	NA
2. P	Q0ZME7	Spike glycoprotein	NA	1.11e-02	NA
2. P	Q09SZ7	Envelope glycoprotein gp63	NA	2.01e-18	NA
2. P	Q2VNF2	Hemagglutinin	NA	3.61e-08	NA
2. P	P10448	Hemagglutinin (Fragment)	NA	9.42e-09	NA
2. P	Q82509	Hemagglutinin	NA	2.34e-06	NA
2. P	P12589	Hemagglutinin	NA	1.06e-04	NA
2. P	P03436	Hemagglutinin	NA	1.11e-06	NA
2. P	P22380	Envelope glycoprotein gp160	NA	1.78e-13	NA
2. P	P19701	Hemagglutinin	NA	1.35e-08	NA
2. P	P07973	Hemagglutinin-esterase-fusion glycoprotein (Fragment)	NA	1.41e-12	NA
2. P	P26103	Hemagglutinin	NA	4.93e-14	NA
2. P	Q9WCE3	Hemagglutinin	NA	2.28e-06	NA
2. P	P32536	Envelope glycoprotein gp160	NA	7.81e-18	NA
2. P	P17504	Hemagglutinin	NA	2.20e-08	NA
2. P	P09343	Hemagglutinin	NA	9.45e-10	NA
2. P	Q67018	Hemagglutinin	NA	1.13e-07	NA
2. P	Q2A069	Pre-glycoprotein polyprotein GP complex	NA	4.47e-02	NA
2. P	P17005	Hemagglutinin-esterase-fusion glycoprotein (Fragment)	NA	7.13e-18	NA
2. P	P03440	Hemagglutinin	NA	3.12e-09	NA
2. P	A4GCK8	Hemagglutinin	NA	8.19e-09	NA
2. P	P27399	Envelope glycoprotein gp130	NA	1.76e-02	NA
2. P	P19106	Hemagglutinin	NA	1.10e-07	NA
2. P	P17003	Hemagglutinin-esterase-fusion glycoprotein (Fragment)	NA	2.82e-19	NA
2. P	Q6DQ20	Hemagglutinin (Fragment)	NA	1.36e-07	NA
2. P	P26141	Hemagglutinin	NA	1.30e-08	NA
2. P	A4GCH5	Hemagglutinin	NA	1.53e-05	NA
2. P	A4GCL9	Hemagglutinin	NA	6.63e-09	NA
2. P	P18876	Hemagglutinin	NA	4.15e-09	NA
2. P	A4U6V2	Hemagglutinin	NA	3.40e-09	NA
2. P	P26135	Hemagglutinin	NA	1.31e-07	NA
2. P	A3EXG6	Spike glycoprotein	NA	4.25e-03	NA
2. P	Q14EB0	Spike glycoprotein	NA	2.91e-02	NA
2. P	P19695	Hemagglutinin	NA	7.54e-08	NA
2. P	P11225	Spike glycoprotein	NA	6.82e-03	NA
2. P	Q6E0W7	Glycoprotein	NA	3.45e-02	NA
2. P	P12587	Hemagglutinin (Fragment)	NA	2.02e-04	NA
2. P	P26097	Hemagglutinin	NA	1.63e-12	NA
2. P	P03451	Hemagglutinin	NA	7.44e-08	NA
2. P	P53122	Uncharacterized protein YGL138C	4.00e-01	2.38e-02	NA
2. P	P19696	Hemagglutinin	NA	1.60e-07	NA
2. P	Q8V3T9	Fusion glycoprotein F0	NA	1.57e-04	NA
2. P	Q9WCE1	Hemagglutinin	NA	1.39e-08	NA
2. P	Q9N2J8	HERV-H_2q24.1 provirus ancestral Env polyprotein	9.45e-02	5.42e-22	NA
2. P	P03454	Hemagglutinin	NA	8.07e-09	NA
2. P	P03458	Hemagglutinin	NA	1.61e-14	NA
2. P	A4GCJ7	Hemagglutinin	NA	3.74e-07	NA
2. P	Q27ID8	Envelope glycoprotein	NA	2.58e-25	NA
2. P	P03456	Hemagglutinin	NA	6.30e-06	NA
2. P	B4URD6	Hemagglutinin	NA	1.26e-07	NA
2. P	Q9JGT4	Glycoprotein	NA	2.13e-02	NA
2. P	Q01977	Spike glycoprotein	NA	4.09e-02	NA
2. P	P06445	Envelope glycoprotein	NA	9.52e-28	NA
2. P	Q6DQ15	Hemagglutinin (Fragment)	NA	5.46e-05	NA
2. P	P03442	Hemagglutinin	NA	4.56e-06	NA
2. P	Q9TTC0	Envelope glycoprotein	NA	1.03e-29	NA
2. P	P03399	Envelope glycoprotein	NA	4.56e-25	NA
2. P	P12582	Hemagglutinin (Fragment)	NA	5.47e-03	NA
2. P	P13103	Hemagglutinin	NA	7.42e-09	NA
2. P	P27427	Envelope glycoprotein	NA	5.03e-03	NA
2. P	P03392	Envelope glycoprotein (Fragment)	NA	2.69e-06	NA
2. P	P04661	Hemagglutinin	NA	3.92e-09	NA
2. P	P07967	Hemagglutinin-esterase-fusion glycoprotein (Fragment)	NA	5.29e-11	NA
2. P	P60608	Endogenous retrovirus group FC1 member 1 Env polyprotein	5.76e-01	3.33e-17	NA
2. P	A4GBX7	Hemagglutinin	NA	4.49e-07	NA
2. P	P61557	Syncytin-2	4.65e-01	5.22e-24	NA
2. P	P61559	ERV-H1 provirus ancestral Env polyprotein	1.57e-01	1.81e-09	NA
2. P	P03460	Hemagglutinin	NA	1.38e-09	NA
2. P	P61563	Syncytin-1	4.03e-01	5.48e-04	NA
2. P	P68761	Hemagglutinin-esterase-fusion glycoprotein (Fragment)	NA	4.59e-15	NA
2. P	P12581	Hemagglutinin	NA	2.35e-13	NA
2. P	Q6DPZ9	Hemagglutinin (Fragment)	NA	1.85e-07	NA
2. P	Q27YE4	Pre-glycoprotein polyprotein GP complex	NA	5.12e-04	NA
2. P	P61556	Syncytin-2	5.68e-01	1.02e-25	NA
2. P	P31796	Envelope glycoprotein	NA	6.64e-31	NA
2. P	P26562	Hemagglutinin	NA	1.32e-08	NA
2. P	A8C8W3	Hemagglutinin	NA	5.43e-06	NA
2. P	Q2RCH5	Hemagglutinin	NA	1.04e-08	NA
2. P	O11283	Hemagglutinin	NA	3.70e-10	NA
2. P	O56140	Hemagglutinin	NA	5.07e-09	NA
2. P	P12439	Hemagglutinin	NA	1.25e-14	NA
2. P	Q9H9K5	Endogenous retroviral envelope protein HEMO	5.33e-01	1.21e-02	NA
2. P	P43258	Hemagglutinin (Fragment)	NA	4.06e-05	NA
2. P	P16995	Hemagglutinin	NA	1.44e-05	NA
2. P	P03393	Glycoprotein 55	NA	1.83e-05	NA
2. P	P03463	Hemagglutinin	NA	1.39e-08	NA
2. P	P03459	Hemagglutinin	NA	1.59e-10	NA
2. P	P60508	Syncytin-2	4.54e-01	5.67e-24	NA
2. P	P04027	Envelope glycoprotein	NA	3.75e-19	NA
2. P	P16998	Hemagglutinin	NA	1.62e-05	NA
2. P	Q07FI5	Hemagglutinin	NA	1.86e-06	NA
2. P	P19697	Hemagglutinin	NA	5.84e-09	NA
2. P	Q2F4V2	Hemagglutinin (Fragment)	NA	2.20e-08	NA
2. P	P11135	Hemagglutinin	NA	2.33e-08	NA
2. P	Q67387	Hemagglutinin-esterase-fusion glycoprotein	NA	2.09e-15	NA
2. P	P19699	Hemagglutinin	NA	3.79e-07	NA
2. P	P25507	Envelope glycoprotein	NA	3.59e-02	NA
2. P	P31627	Envelope glycoprotein	NA	1.31e-11	NA
2. P	P03394	Glycoprotein 55	NA	3.69e-05	NA
2. P	Q04993	Envelope glycoprotein gp150	NA	2.75e-25	NA
2. P	Q80A30	Hemagglutinin (Fragment)	NA	4.37e-07	NA
2. P	P19698	Hemagglutinin	NA	6.47e-10	NA
2. P	P61554	Syncytin-2	3.79e-01	4.47e-25	NA
2. P	P07977	Hemagglutinin (Fragment)	NA	3.39e-05	NA
2. P	Q67282	Hemagglutinin	NA	2.80e-07	NA
2. P	P03438	Hemagglutinin	NA	1.34e-08	NA
2. P	P51520	Envelope glycoprotein	NA	6.65e-14	NA
2. P	P16899	Envelope glycoprotein gp160	NA	3.16e-12	NA
2. P	Q0Q466	Spike glycoprotein	NA	3.45e-02	NA
2. P	P09766	Hemagglutinin (Fragment)	NA	1.88e-05	NA
2. P	Q0HD60	Hemagglutinin	NA	2.03e-08	NA
2. P	P51515	Envelope glycoprotein	NA	3.60e-16	NA
2. P	P23422	Envelope glycoprotein gp160	NA	2.20e-08	NA
2. P	P19700	Hemagglutinin	NA	3.92e-09	NA
2. P	P31791	Envelope glycoprotein	NA	4.48e-23	NA
2. P	P43257	Hemagglutinin (Fragment)	NA	1.66e-04	NA
2. P	P03391	Envelope glycoprotein	NA	1.74e-24	NA
2. P	P03452	Hemagglutinin	NA	7.63e-09	NA
2. P	Q289M7	Hemagglutinin	NA	1.03e-07	NA
2. P	P17000	Hemagglutinin	NA	2.65e-06	NA
2. P	P08359	Envelope glycoprotein	NA	3.65e-26	NA
2. P	P10404	MLV-related proviral Env polyprotein	3.13e-01	3.67e-24	NA
2. P	P03441	Hemagglutinin (Fragment)	NA	1.35e-04	NA
2. P	A3DRP0	Hemagglutinin	NA	3.61e-08	NA
2. P	Q6J8F6	Hemagglutinin (Fragment)	NA	1.71e-07	NA
2. P	P26101	Hemagglutinin	NA	3.06e-12	NA
2. P	Q79670	Envelope glycoprotein gp160	NA	4.13e-02	NA
2. P	P21412	Envelope glycoprotein	NA	7.94e-20	NA
2. P	P13101	Hemagglutinin	NA	9.82e-11	NA
2. P	P03446	Hemagglutinin	NA	4.46e-14	NA
2. P	Q30NQ1	Hemagglutinin	NA	9.36e-08	NA
2. P	P26100	Hemagglutinin	NA	6.53e-13	NA
2. P	Q6DQ18	Hemagglutinin (Fragment)	NA	4.20e-07	NA
2. P	P21415	Envelope glycoprotein	NA	1.29e-30	NA
2. P	P23073	Envelope glycoprotein gp130	NA	8.96e-05	NA
2. P	P26098	Hemagglutinin	NA	2.29e-14	NA
2. P	P03449	Hemagglutinin	NA	6.50e-08	NA
2. P	P36346	Hemagglutinin	NA	1.35e-13	NA
2. P	P22092	Hemagglutinin	NA	8.50e-07	NA
2. P	P15423	Spike glycoprotein	NA	4.13e-02	NA
2. P	P03453	Hemagglutinin	NA	2.82e-08	NA
2. P	Q6LEJ4	Hemagglutinin	NA	8.72e-13	NA
2. P	P07946	Spike glycoprotein	NA	2.20e-02	NA
2. P	P31789	Envelope glycoprotein	NA	4.51e-18	NA
2. P	B6SEH8	Endogenous retrovirus group V member 1 Env polyprotein	3.80e-01	1.46e-20	NA
2. P	P09765	Hemagglutinin (Fragment)	NA	5.91e-07	NA
2. P	P18450	Spike glycoprotein	NA	1.16e-02	NA
2. P	Q6DQ21	Hemagglutinin (Fragment)	NA	2.39e-08	NA
2. P	P03462	Hemagglutinin (Fragment)	NA	2.26e-07	NA
2. P	Q2ICR0	Hemagglutinin	NA	1.54e-07	NA
2. P	P26136	Hemagglutinin	NA	3.61e-08	NA
2. P	P07975	Hemagglutinin-esterase-fusion glycoprotein	NA	3.53e-13	NA
2. P	A8C8J4	Hemagglutinin	NA	2.60e-08	NA
2. P	Q05320	Envelope glycoprotein	NA	3.59e-03	NA
2. P	P03396	Envelope glycoprotein gp95	NA	1.51e-19	NA
2. P	A3EX94	Spike glycoprotein	NA	2.91e-02	NA
2. P	P19030	Envelope glycoprotein gp150	NA	7.87e-21	NA
2. P	Q03816	Envelope glycoprotein gp62	NA	5.12e-17	NA
2. P	P33470	Spike glycoprotein	NA	2.22e-02	NA
2. P	Q0R5Q9	Envelope glycoprotein gp63	NA	2.57e-19	NA
2. P	P59594	Spike glycoprotein	NA	1.68e-05	NA
2. P	P21443	Envelope glycoprotein	NA	5.31e-20	NA
2. P	P60509	Endogenous retrovirus group PABLB member 1 Env polyprotein	3.10e-01	6.60e-05	NA
2. P	P09344	Hemagglutinin	NA	1.02e-09	NA
2. P	Q04995	Envelope glycoprotein gp150	NA	2.54e-23	NA
2. P	P03455	Hemagglutinin	NA	1.38e-07	NA
2. P	Q05312	Envelope glycoprotein gp150	NA	9.49e-24	NA
2. P	J7HBH4	Glycoprotein	NA	2.20e-07	NA
2. P	P03464	Hemagglutinin	NA	1.92e-08	NA
2. P	Q6J8E7	Hemagglutinin (Fragment)	NA	6.39e-07	NA
2. P	P26804	Envelope glycoprotein	NA	3.89e-26	NA
2. P	Q2F7I8	Envelope glycoprotein	NA	6.97e-24	NA
2. P	P03390	Envelope glycoprotein	NA	2.78e-27	NA
2. P	O89746	Hemagglutinin	NA	3.76e-09	NA
2. P	Q5GA86	Glycoprotein	NA	3.03e-02	NA
2. P	P08360	Envelope glycoprotein	NA	1.61e-26	NA
2. P	P11132	Hemagglutinin	NA	2.06e-08	NA
2. P	P0C212	Envelope glycoprotein gp62	NA	2.28e-17	NA
2. P	Q0A3Y1	Hemagglutinin	NA	7.05e-11	NA
2. P	Q0Q475	Spike glycoprotein	NA	1.10e-05	NA
2. P	P26102	Hemagglutinin	NA	5.63e-14	NA
2. P	P61561	Syncytin-1	6.94e-01	4.84e-04	NA
2. P	P61555	Syncytin-2	4.29e-01	2.05e-25	NA
2. P	P21445	Envelope glycoprotein	NA	4.66e-25	NA
2. P	Q02282	Envelope glycoprotein gp150	NA	1.09e-21	NA
2. P	P03388	Envelope glycoprotein	NA	7.81e-28	NA
2. P	P12588	Hemagglutinin (Fragment)	NA	1.60e-04	NA
2. P	Q5G5D5	Syncytin-A	3.10e-01	2.30e-21	NA
2. P	Q08011	Hemagglutinin	NA	8.07e-08	NA
2. P	D0QX25	Envelope glycoprotein	NA	3.32e-02	NA
2. P	P10757	Hemagglutinin	NA	2.43e-08	NA
2. P	P26138	Hemagglutinin	NA	5.36e-06	NA
2. P	Q14264	Endogenous retrovirus group 3 member 1 Env polyprotein	7.79e-01	2.78e-08	NA
2. P	P03461	Hemagglutinin (Fragment)	NA	3.11e-08	NA
2. P	P11268	Envelope glycoprotein	NA	1.07e-22	NA
2. P	A4U7A6	Hemagglutinin	NA	6.90e-07	NA
2. P	P23423	Envelope glycoprotein gp160	NA	1.08e-09	NA
2. P	P26803	Envelope glycoprotein	NA	5.37e-28	NA
2. P	P07976	Hemagglutinin	NA	2.90e-06	NA
2. P	P26134	Hemagglutinin	NA	3.61e-08	NA
2. P	P26099	Hemagglutinin	NA	2.82e-13	NA
2. P	P11261	Envelope glycoprotein	NA	3.07e-26	NA
2. P	Q2VND2	Hemagglutinin	NA	4.03e-08	NA
2. P	P60507	Endogenous retrovirus group FC1 Env polyprotein	5.45e-01	2.99e-14	NA
2. P	P0DTC2	Spike glycoprotein	NA	9.02e-06	NA
2. P	P12583	Hemagglutinin	NA	2.95e-07	NA
2. P	P12586	Hemagglutinin (Fragment)	NA	1.78e-04	NA
2. P	P17004	Hemagglutinin-esterase-fusion glycoprotein (Fragment)	NA	7.00e-18	NA
2. P	Q6DQ22	Hemagglutinin (Fragment)	NA	7.97e-05	NA
2. P	P87506	Hemagglutinin	NA	9.36e-06	NA
2. P	Q38SQ8	Hemagglutinin	NA	9.73e-10	NA
2. P	P03385	Envelope glycoprotein	NA	7.09e-27	NA
2. P	Q8BI41	Syncytin-B	1.73e-01	1.40e-25	NA
2. P	P61553	Syncytin-2	2.89e-01	2.48e-23	NA
2. P	P68762	Hemagglutinin-esterase-fusion glycoprotein	NA	3.48e-16	NA
2. P	P03379	Envelope glycoprotein gp160	NA	4.46e-09	NA
2. P	P03465	Hemagglutinin-esterase-fusion glycoprotein	NA	3.87e-15	NA
2. P	Q8MIB6	Endogenous retrovirus group FC1 Env polyprotein	4.08e-01	5.54e-15	NA
2. P	P16999	Hemagglutinin	NA	1.19e-07	NA
2. P	Q9N2K0	HERV-H_2q24.3 provirus ancestral Env polyprotein	1.01e-01	1.21e-17	NA
2. P	Q1PUD9	Hemagglutinin	NA	2.62e-07	NA
2. P	P15073	Envelope glycoprotein	NA	2.76e-26	NA
2. P	P16090	Envelope glycoprotein gp150	NA	4.24e-26	NA
2. P	Q8QPL1	Hemagglutinin	NA	2.48e-07	NA
2. P	Q9WCD9	Hemagglutinin	NA	1.58e-08	NA
2. P	P03457	Hemagglutinin	NA	2.85e-14	NA
2. P	P15658	Hemagglutinin	NA	8.52e-08	NA
2. P	Q03909	Hemagglutinin	NA	1.66e-05	NA
2. P	Q67333	Hemagglutinin	NA	4.32e-07	NA
2. P	Q2RFA5	Hemagglutinin	NA	1.74e-08	NA
2. P	P13102	Hemagglutinin	NA	1.84e-08	NA
2. P	Q91MA7	Hemagglutinin	NA	3.03e-07	NA
2. P	P23064	Envelope glycoprotein gp62	NA	4.13e-17	NA
2. P	P11370	Retrovirus-related Env polyprotein from Fv-4 locus	3.55e-01	3.57e-22	NA
3. B	P63135	Endogenous retrovirus group K member 7 Pol protein	8.01e-08	NA	0.0
3. B	Q9HDB8	Endogenous retrovirus group K member 5 Env polyprotein	1.10e-01	NA	2.19e-162
3. B	P61571	Endogenous retrovirus group K member 21 Rec protein	1.87e-01	NA	2.04e-48
3. B	P61572	Endogenous retrovirus group K member 19 Rec protein	2.74e-01	NA	8.10e-52
3. B	Q69383	Endogenous retrovirus group K member 6 Rec protein	1.91e-01	NA	8.10e-52
3. B	P10266	Endogenous retrovirus group K member 10 Pol protein	8.90e-01	NA	1.44e-87
3. B	P61578	Endogenous retrovirus group K member 16 Rec protein	2.62e-01	NA	8.06e-29
3. B	Q9UQG0	Endogenous retrovirus group K member 11 Pol protein	8.72e-01	NA	1.62e-53
3. B	P61579	Endogenous retrovirus group K member 25 Rec protein	1.55e-01	NA	8.10e-52
3. B	P61573	Endogenous retrovirus group K member 9 Rec protein	2.41e-01	NA	8.10e-52
3. B	P61574	Endogenous retrovirus group K member 113 Rec protein	2.87e-01	NA	1.29e-51
3. B	P61568	Putative endogenous retrovirus group K member 11-1 Env polyprotein	9.34e-01	NA	6.12e-30
3. B	P61575	Endogenous retrovirus group K member 8 Rec protein	2.57e-01	NA	7.61e-52
3. B	P61576	Endogenous retrovirus group K member 104 Rec protein	3.20e-01	NA	1.10e-46
3. B	Q3V3Q4	Pyrin domain-containing protein 3	9.79e-01	NA	0.001