Summary

P61571

Homolog: P61579.
Function: Endogenous retrovirus group K member 25 Rec protein.

Statistics

Total GO Annotation: 19
Unique PROST Go: 3
Unique BLAST Go: 10

Total Homologs: 19
Unique PROST Homologs: 1
Unique BLAST Homologs: 9

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P61579 (Endogenous retrovirus group K member 25 Rec protein) with a FATCAT P-Value: 7.47e-12 and RMSD of 3.33 angstrom. The sequence alignment identity is 98.1%.
Structural alignment shown in left. Query protein P61571 colored as red in alignment, homolog P61579 colored as blue. Query protein P61571 is also shown in right top, homolog P61579 showed in right bottom. They are colored based on secondary structures. 

  P61571 MHPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTS-EQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSAGVPNSSEETAT 99
  P61579 MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSAGVPNSSEETAT 100

  P61571 IENGP 104
  P61579 IENGP 105

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0003723 RNA binding
1. PB GO:0006406 mRNA export from nucleus
1. PB GO:0051260 protein homooligomerization
1. PB GO:0051028 mRNA transport
1. PB GO:0035613 RNA stem-loop binding
1. PB GO:0005730 nucleolus
2. P GO:0005737 cytoplasm
2. P GO:0051087 chaperone binding
2. P GO:0010628 positive regulation of gene expression
3. B GO:0005198 structural molecule activity
3. B GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
3. B GO:0005886 plasma membrane
3. B GO:0090309 positive regulation of DNA methylation-dependent heterochromatin assembly
3. B GO:0097355 protein localization to heterochromatin
3. B GO:0031424 keratinization
3. B GO:0002218 activation of innate immune response
3. B GO:0035458 cellular response to interferon-beta
3. B GO:0016021 integral component of membrane
3. B GO:0045814 negative regulation of gene expression, epigenetic

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P61571 Endogenous retrovirus group K member 21 Rec protein 0 1.99e-140 8.74e-71
1. PB P61572 Endogenous retrovirus group K member 19 Rec protein 3.74e-11 2.14e-54 5.87e-68
1. PB Q69383 Endogenous retrovirus group K member 6 Rec protein 1.63e-10 2.14e-54 5.87e-68
1. PB P61578 Endogenous retrovirus group K member 16 Rec protein 7.93e-11 4.76e-34 5.64e-44
1. PB P61573 Endogenous retrovirus group K member 9 Rec protein 2.49e-08 2.14e-54 5.87e-68
1. PB P61579 Endogenous retrovirus group K member 25 Rec protein 7.47e-12 2.14e-54 5.87e-68
1. PB P61574 Endogenous retrovirus group K member 113 Rec protein 2.93e-05 1.49e-39 4.42e-67
1. PB P61575 Endogenous retrovirus group K member 8 Rec protein 9.83e-09 1.73e-38 1.31e-66
1. PB P61576 Endogenous retrovirus group K member 104 Rec protein 2.30e-07 1.78e-28 6.02e-62
2. P Q4R7E8 TSSK6-activating co-chaperone protein 1.27e-02 8.49e-03 NA
3. B O71037 Endogenous retrovirus group K member 19 Env polyprotein 2.96e-01 NA 4.08e-49
3. B Q902F8 Endogenous retrovirus group K member 8 Env polyprotein 1.65e-01 NA 4.47e-49
3. B P61570 Endogenous retrovirus group K member 25 Env polyprotein 1.87e-01 NA 3.20e-49
3. B Q69384 Endogenous retrovirus group K member 6 Env polyprotein 1.39e-01 NA 3.69e-49
3. B P61565 Endogenous retrovirus group K member 21 Env polyprotein 4.32e-02 NA 6.76e-52
3. B Q902F9 Endogenous retrovirus group K member 113 Env polyprotein 3.11e-01 NA 3.36e-49
3. B Q8NEY8 Periphilin-1 4.45e-02 NA 0.046
3. B Q9UKH3 Endogenous retrovirus group K member 9 Env polyprotein 1.11e-01 NA 3.97e-49
3. B Q3V3Q4 Pyrin domain-containing protein 3 8.04e-02 NA 1.27e-04