Summary

P61580

Homolog: P61581.
Function: Endogenous retrovirus group K member 24 Np9 protein.

Statistics

Total GO Annotation: 17
Unique PROST Go: 16
Unique BLAST Go: 0

Total Homologs: 25
Unique PROST Homologs: 21
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P61581 (Endogenous retrovirus group K member 24 Np9 protein) with a FATCAT P-Value: 1.27e-07 and RMSD of 1.97 angstrom. The sequence alignment identity is 98.7%.
Structural alignment shown in left. Query protein P61580 colored as red in alignment, homolog P61581 colored as blue. Query protein P61580 is also shown in right top, homolog P61581 showed in right bottom. They are colored based on secondary structures. 

  P61580 MNPSEMQRKGPPRRWCLQVYPTAPKRQRPSRTGHDDDGGFVEKKRGKCGEKQERSNCYCVCVERSRHRRLHFVMC 75
  P61581 MNPSEMQRKGPPRRWCLQVYPTAPKRQRPSRTGHDDDGGFVEKKRGKCGEKQERSDCYCVCVERSRHRRLHFVMC 75

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005634 nucleus
2. P GO:0042025 host cell nucleus
2. P GO:0000772 mating pheromone activity
2. P GO:0045664 regulation of neuron differentiation
2. P GO:0090729 toxin activity
2. P GO:0030354 melanin-concentrating hormone activity
2. P GO:0005576 extracellular region
2. P GO:0031103 axon regeneration
2. P GO:0030430 host cell cytoplasm
2. P GO:0031777 type 1 melanin-concentrating hormone receptor binding
2. P GO:0030435 sporulation resulting in formation of a cellular spore
2. P GO:0000282 cellular bud site selection
2. P GO:0039592 suppression by virus of G2/M transition of host mitotic cell cycle
2. P GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
2. P GO:0006113 fermentation
2. P GO:0007268 chemical synaptic transmission
2. P GO:0017015 regulation of transforming growth factor beta receptor signaling pathway

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P61583 Endogenous retrovirus group K member 5 Np9 protein 1.05e-04 1.42e-93 1.23e-48
1. PB P61581 Endogenous retrovirus group K member 24 Np9 protein 1.27e-07 1.23e-120 2.46e-50
1. PB P61580 Endogenous retrovirus group K member 10 Np9 protein 0 6.76e-160 4.73e-51
1. PB P61582 Endogenous retrovirus group K member 7 Np9 protein 4.35e-02 6.96e-84 1.74e-48
2. P P34166 Mating hormone A-factor 2 7.15e-02 2.93e-03 NA
2. P Q55G14 Putative uncharacterized protein DDB_G0268370 2.44e-01 1.42e-03 NA
2. P P75692 Uncharacterized protein YahM 5.90e-01 1.31e-02 NA
2. P P10304 Gene 19.3 protein NA 4.13e-02 NA
2. P Q7WY63 Protein AntE 1.86e-01 2.13e-02 NA
2. P Q03783 Putative uncharacterized protein BUD26 8.03e-01 4.55e-02 NA
2. P Q9ZDV9 Uncharacterized protein RP207 8.58e-01 4.55e-02 NA
2. P Q9BZP3 Putative uncharacterized protein encoded by LINC00470 5.09e-01 1.12e-02 NA
2. P Q16048 Putative pro-MCH-like protein 1 3.36e-01 1.07e-02 NA
2. P F5CEP0 Conotoxin Cal12.1p1 (Fragment) 8.31e-01 2.93e-03 NA
2. P G1C1T1 Conotoxin Cal12.1p3 (Fragment) 6.73e-01 2.49e-03 NA
2. P P10435 Uncharacterized immunity region protein 12 NA 8.94e-03 NA
2. P Q05898 Uncharacterized protein YLR296W 2.67e-01 3.62e-03 NA
2. P G1C1T0 Conotoxin Cal12.1p2 (Fragment) 8.78e-01 9.32e-03 NA
2. P Q9C0X4 Putative uncharacterized protein C12C2.14c 3.53e-01 1.40e-03 NA
2. P Q54FF1 UPF0512 protein C 1.59e-01 3.09e-02 NA
2. P P06424 Protein E4 NA 8.76e-03 NA
2. P Q3E7Z0 Uncharacterized protein YNL277W-A 2.76e-01 1.14e-03 NA
2. P Q90667 Neuronal regeneration-related protein 2.16e-01 6.33e-04 NA
2. P P17384 Protein E4 NA 9.44e-04 NA
2. P Q4R541 Neuronal regeneration-related protein 4.79e-01 7.65e-03 NA