Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P61581
(Endogenous retrovirus group K member 24 Np9 protein) with a FATCAT P-Value: 1.27e-07 and RMSD of 1.97 angstrom. The sequence alignment identity is 98.7%.
Structural alignment shown in left. Query protein P61580 colored as red in alignment, homolog P61581 colored as blue.
Query protein P61580 is also shown in right top, homolog P61581 showed in right bottom. They are colored based on secondary structures.
P61580 MNPSEMQRKGPPRRWCLQVYPTAPKRQRPSRTGHDDDGGFVEKKRGKCGEKQERSNCYCVCVERSRHRRLHFVMC 75 P61581 MNPSEMQRKGPPRRWCLQVYPTAPKRQRPSRTGHDDDGGFVEKKRGKCGEKQERSDCYCVCVERSRHRRLHFVMC 75
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005634 | nucleus |
| 2. P | GO:0042025 | host cell nucleus |
| 2. P | GO:0000772 | mating pheromone activity |
| 2. P | GO:0045664 | regulation of neuron differentiation |
| 2. P | GO:0090729 | toxin activity |
| 2. P | GO:0030354 | melanin-concentrating hormone activity |
| 2. P | GO:0005576 | extracellular region |
| 2. P | GO:0031103 | axon regeneration |
| 2. P | GO:0030430 | host cell cytoplasm |
| 2. P | GO:0031777 | type 1 melanin-concentrating hormone receptor binding |
| 2. P | GO:0030435 | sporulation resulting in formation of a cellular spore |
| 2. P | GO:0000282 | cellular bud site selection |
| 2. P | GO:0039592 | suppression by virus of G2/M transition of host mitotic cell cycle |
| 2. P | GO:0000750 | pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| 2. P | GO:0006113 | fermentation |
| 2. P | GO:0007268 | chemical synaptic transmission |
| 2. P | GO:0017015 | regulation of transforming growth factor beta receptor signaling pathway |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P61583 | Endogenous retrovirus group K member 5 Np9 protein | 1.05e-04 | 1.42e-93 | 1.23e-48 |
| 1. PB | P61581 | Endogenous retrovirus group K member 24 Np9 protein | 1.27e-07 | 1.23e-120 | 2.46e-50 |
| 1. PB | P61580 | Endogenous retrovirus group K member 10 Np9 protein | 0 | 6.76e-160 | 4.73e-51 |
| 1. PB | P61582 | Endogenous retrovirus group K member 7 Np9 protein | 4.35e-02 | 6.96e-84 | 1.74e-48 |
| 2. P | P34166 | Mating hormone A-factor 2 | 7.15e-02 | 2.93e-03 | NA |
| 2. P | Q55G14 | Putative uncharacterized protein DDB_G0268370 | 2.44e-01 | 1.42e-03 | NA |
| 2. P | P75692 | Uncharacterized protein YahM | 5.90e-01 | 1.31e-02 | NA |
| 2. P | P10304 | Gene 19.3 protein | NA | 4.13e-02 | NA |
| 2. P | Q7WY63 | Protein AntE | 1.86e-01 | 2.13e-02 | NA |
| 2. P | Q03783 | Putative uncharacterized protein BUD26 | 8.03e-01 | 4.55e-02 | NA |
| 2. P | Q9ZDV9 | Uncharacterized protein RP207 | 8.58e-01 | 4.55e-02 | NA |
| 2. P | Q9BZP3 | Putative uncharacterized protein encoded by LINC00470 | 5.09e-01 | 1.12e-02 | NA |
| 2. P | Q16048 | Putative pro-MCH-like protein 1 | 3.36e-01 | 1.07e-02 | NA |
| 2. P | F5CEP0 | Conotoxin Cal12.1p1 (Fragment) | 8.31e-01 | 2.93e-03 | NA |
| 2. P | G1C1T1 | Conotoxin Cal12.1p3 (Fragment) | 6.73e-01 | 2.49e-03 | NA |
| 2. P | P10435 | Uncharacterized immunity region protein 12 | NA | 8.94e-03 | NA |
| 2. P | Q05898 | Uncharacterized protein YLR296W | 2.67e-01 | 3.62e-03 | NA |
| 2. P | G1C1T0 | Conotoxin Cal12.1p2 (Fragment) | 8.78e-01 | 9.32e-03 | NA |
| 2. P | Q9C0X4 | Putative uncharacterized protein C12C2.14c | 3.53e-01 | 1.40e-03 | NA |
| 2. P | Q54FF1 | UPF0512 protein C | 1.59e-01 | 3.09e-02 | NA |
| 2. P | P06424 | Protein E4 | NA | 8.76e-03 | NA |
| 2. P | Q3E7Z0 | Uncharacterized protein YNL277W-A | 2.76e-01 | 1.14e-03 | NA |
| 2. P | Q90667 | Neuronal regeneration-related protein | 2.16e-01 | 6.33e-04 | NA |
| 2. P | P17384 | Protein E4 | NA | 9.44e-04 | NA |
| 2. P | Q4R541 | Neuronal regeneration-related protein | 4.79e-01 | 7.65e-03 | NA |