Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P61580
(Endogenous retrovirus group K member 10 Np9 protein) with a FATCAT P-Value: 0.0456 and RMSD of 3.50 angstrom. The sequence alignment identity is 96.0%.
Structural alignment shown in left. Query protein P61582 colored as red in alignment, homolog P61580 colored as blue.
Query protein P61582 is also shown in right top, homolog P61580 showed in right bottom. They are colored based on secondary structures.
P61582 MNPLEMQRKGPPRRWCLQVYPTAPKRQRPSRTGHDDDGGFVEKKRGKCGEKQERSDCYCVCVERSRHGRLHFVMC 75 P61580 MNPSEMQRKGPPRRWCLQVYPTAPKRQRPSRTGHDDDGGFVEKKRGKCGEKQERSNCYCVCVERSRHRRLHFVMC 75
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005634 | nucleus |
| 2. P | GO:0030435 | sporulation resulting in formation of a cellular spore |
| 2. P | GO:0045664 | regulation of neuron differentiation |
| 2. P | GO:0000772 | mating pheromone activity |
| 2. P | GO:0000750 | pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| 2. P | GO:0039592 | suppression by virus of G2/M transition of host mitotic cell cycle |
| 2. P | GO:0090729 | toxin activity |
| 2. P | GO:0030354 | melanin-concentrating hormone activity |
| 2. P | GO:0005576 | extracellular region |
| 2. P | GO:0005739 | mitochondrion |
| 2. P | GO:0006113 | fermentation |
| 2. P | GO:0031103 | axon regeneration |
| 2. P | GO:0007268 | chemical synaptic transmission |
| 2. P | GO:0017015 | regulation of transforming growth factor beta receptor signaling pathway |
| 2. P | GO:0031777 | type 1 melanin-concentrating hormone receptor binding |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P61583 | Endogenous retrovirus group K member 5 Np9 protein | 1.35e-01 | 8.17e-75 | 3.54e-47 |
| 1. PB | P61581 | Endogenous retrovirus group K member 24 Np9 protein | 1.82e-01 | 5.43e-88 | 5.10e-49 |
| 1. PB | P61582 | Endogenous retrovirus group K member 7 Np9 protein | 0 | 2.49e-161 | 4.73e-51 |
| 1. PB | P61580 | Endogenous retrovirus group K member 10 Np9 protein | 4.56e-02 | 4.70e-84 | 1.74e-48 |
| 2. P | Q8TGR0 | Putative uncharacterized protein YLR437C-A | 3.76e-01 | 2.37e-02 | NA |
| 2. P | P34166 | Mating hormone A-factor 2 | 4.86e-01 | 6.38e-03 | NA |
| 2. P | Q55G14 | Putative uncharacterized protein DDB_G0268370 | 3.15e-01 | 1.24e-03 | NA |
| 2. P | P75692 | Uncharacterized protein YahM | 5.40e-01 | 2.01e-03 | NA |
| 2. P | Q7WY63 | Protein AntE | 3.36e-01 | 7.02e-03 | NA |
| 2. P | P86355 | Canavanine hydrolase (Fragments) | NA | 2.07e-02 | NA |
| 2. P | Q9ZDV9 | Uncharacterized protein RP207 | 7.32e-01 | 2.07e-02 | NA |
| 2. P | Q9BZP3 | Putative uncharacterized protein encoded by LINC00470 | 7.36e-01 | 2.27e-03 | NA |
| 2. P | Q16048 | Putative pro-MCH-like protein 1 | 4.34e-01 | 1.88e-03 | NA |
| 2. P | Q5NVD3 | Neuronal regeneration-related protein | 4.80e-01 | 3.31e-02 | NA |
| 2. P | F5CEP0 | Conotoxin Cal12.1p1 (Fragment) | 7.56e-01 | 1.39e-02 | NA |
| 2. P | P03860 | Uncharacterized 8.7 kDa protein | 7.65e-01 | 4.17e-02 | NA |
| 2. P | P10435 | Uncharacterized immunity region protein 12 | NA | 4.44e-03 | NA |
| 2. P | Q05898 | Uncharacterized protein YLR296W | 8.65e-01 | 1.46e-03 | NA |
| 2. P | P92526 | Uncharacterized mitochondrial protein AtMg00890 | 4.03e-01 | 3.18e-02 | NA |
| 2. P | P93318 | Uncharacterized mitochondrial protein AtMg00660 | 4.05e-01 | 1.45e-02 | NA |
| 2. P | O13574 | Uncharacterized protein YLR255C | 7.35e-01 | 2.44e-02 | NA |
| 2. P | G1C1T0 | Conotoxin Cal12.1p2 (Fragment) | 8.55e-01 | 2.37e-02 | NA |
| 2. P | Q9C0X4 | Putative uncharacterized protein C12C2.14c | 4.06e-01 | 2.22e-03 | NA |
| 2. P | Q54FF1 | UPF0512 protein C | 5.60e-01 | 9.73e-03 | NA |
| 2. P | A6NGG3 | Putative uncharacterized protein C9orf92 | 5.23e-01 | 2.27e-02 | NA |
| 2. P | Q16612 | Neuronal regeneration-related protein | 3.43e-01 | 4.38e-02 | NA |
| 2. P | Q3E7Z0 | Uncharacterized protein YNL277W-A | 2.54e-01 | 1.06e-03 | NA |
| 2. P | Q90667 | Neuronal regeneration-related protein | 1.88e-01 | 2.37e-03 | NA |
| 2. P | P17384 | Protein E4 | NA | 8.00e-04 | NA |
| 2. P | Q4R541 | Neuronal regeneration-related protein | 2.53e-01 | 4.83e-05 | NA |