Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P63145
(Endogenous retrovirus group K member 24 Gag polyprotein) with a FATCAT P-Value: 1.22e-15 and RMSD of 2.50 angstrom. The sequence alignment identity is 98.0%.
Structural alignment shown in left. Query protein P62683 colored as red in alignment, homolog P63145 colored as blue.
Query protein P62683 is also shown in right top, homolog P63145 showed in right bottom. They are colored based on secondary structures.
P62683 MGQTKSKIKSKYASYLSFIKILLKRGGVKVSTKNLIKLFQIIEQFCPWFPEQGTLDLKDWKRIGKELKQAGRKGNIIPLTVWNDWAIIKAALEPFQTEED 100 P63145 MGQTKSKIKSKYASYLSFIKILLKRGGVKVSTKNLIKLFQIIEQFCPWFPEQGTLDLKDWKRIGKELKQAGRKGNIIPLTVWNDWAIIKAALEPFQTEED 100 P62683 SISVSDAPGSCIIDCNENTRKKSQKETEGLHCEYAAEPVMAQSTQNVDYNQLQEVIYPETLKLEGKGPELVGPSESKPRGTSPLPAGQVPVTLQPQTQVK 200 P63145 SVSVSDAPGSCLIDCNEKTRKKSQKETESLHCEYVAEPVMAQSTQNVDYNQLQEVIYPETLKLEGKGPELVGPSESKPRGTSPLPAGQVPVTLQPQKQVK 200 P62683 ENKTQPPVAYQYWPPAELQYRPPPESQYGYPGMPPAPQGRAPYPQPPTRRLNPTAPPSRQGSELHEIIDKSRKEGDTEAWQFPVMLEPMPPGEGAQEGEP 300 P63145 ENKTQPPVAYQYWPPAELQYRPPPESQYGYPGMPPAPQGRAPYPQPPTRRLNPTAPPSRQGSELHEIIDKSRKEGDTEAWQFPVTLEPMPPGEGAQEGEP 300 P62683 PTVEARYKSFSIKMLKDMKEGVKQYGPNSPYMRTLLDSIAHGHRLIPYDWEILAKSSLLPSQFLQFKTWWIDGVQEQVQRNRAANPPVNIDADQLLGIGQ 400 P63145 PTVEARYKSFSIKMLKDMKEGVKQYGPNSPYMRTLLDSIAYGHRLIPYDWEILAKSSLSPSQFLQFKTWWIDGVQEQVRRNRAANPPVNIDADQLLGIGQ 400 P62683 NWSTISQQALMQNEAIEQVRAICLRAWEKIQDPGSTCPSFNTVRQSSKEPYPDFVARLQDVAQKSIADEKARKVIVELMAYENANPECQSAIKPLKGKVP 500 P63145 NWSTISQQALMQNEAIEQVRAICLRAWEKIQDPGSACPSFNTVRQGSKEPYPDFVARLQDVAQKSIADEKARKVIVELMAYENANPECQSAIKPLKGKVP 500 P62683 AGSDVISEYVKACDGIGGAMHKAMLMAQAITGVVLGGQVRTFGGKCYNCGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQCRSKFD 600 P63145 AGSDVISEYVKACDGIGGAMHKAMLMAQAITGVVLGGQVRTFGGKCYNCGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQCRSKFD 600 P62683 KNGQPLSGNEQRGQPQAPQQTGAFPIQPFVPQGFQGQQPPLSQVFQGISQLPQYNNCPPPQAAVQQ 666 P63145 KNGQPLSGNEQRGQPQAPQQTGAFPIQPFVPQGFQGQQPPLSQVFQGISQLPQYNNCPLPQAAVQQ 666
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005737 | cytoplasm |
| 1. PB | GO:0016032 | viral process |
| 1. PB | GO:0044196 | host cell nucleolus |
| 1. PB | GO:0008270 | zinc ion binding |
| 1. PB | GO:0016020 | membrane |
| 1. PB | GO:0030430 | host cell cytoplasm |
| 1. PB | GO:0019013 | viral nucleocapsid |
| 1. PB | GO:0004190 | aspartic-type endopeptidase activity |
| 1. PB | GO:0046797 | viral procapsid maturation |
| 1. PB | GO:0039702 | viral budding via host ESCRT complex |
| 1. PB | GO:0020002 | host cell plasma membrane |
| 1. PB | GO:0003676 | nucleic acid binding |
| 1. PB | GO:0042025 | host cell nucleus |
| 1. PB | GO:0005198 | structural molecule activity |
| 1. PB | GO:0044095 | host cell nucleoplasm |
| 1. PB | GO:0005634 | nucleus |
| 1. PB | GO:0003723 | RNA binding |
| 1. PB | GO:0019028 | viral capsid |
| 1. PB | GO:0039660 | structural constituent of virion |
| 1. PB | GO:0055036 | virion membrane |
| 1. PB | GO:0072494 | host multivesicular body |
| 2. P | GO:0019076 | viral release from host cell |
| 2. P | GO:1903561 | extracellular vesicle |
| 2. P | GO:0050804 | modulation of chemical synaptic transmission |
| 2. P | GO:1900452 | regulation of long-term synaptic depression |
| 2. P | GO:0022604 | regulation of cell morphogenesis |
| 2. P | GO:0044163 | host cytoskeleton |
| 2. P | GO:0120026 | host cell uropod |
| 2. P | GO:0044383 | host chromosome |
| 2. P | GO:0001844 | protein insertion into mitochondrial membrane involved in apoptotic signaling pathway |
| 2. P | GO:0019068 | virion assembly |
| 2. P | GO:2000969 | positive regulation of AMPA receptor activity |
| 2. P | GO:0098845 | postsynaptic endosome |
| 2. P | GO:0075521 | microtubule-dependent intracellular transport of viral material towards nucleus |
| 2. P | GO:0007616 | long-term memory |
| 2. P | GO:0002437 | inflammatory response to antigenic stimulus |
| 2. P | GO:0071598 | neuronal ribonucleoprotein granule |
| 2. P | GO:0044185 | host cell late endosome membrane |
| 2. P | GO:0110077 | vesicle-mediated intercellular transport |
| 2. P | GO:0048168 | regulation of neuronal synaptic plasticity |
| 2. P | GO:0005730 | nucleolus |
| 2. P | GO:1900271 | regulation of long-term synaptic potentiation |
| 3. B | GO:0046718 | viral entry into host cell |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0044823 | retroviral integrase activity |
| 3. B | GO:0075732 | viral penetration into host nucleus |
| 3. B | GO:0071037 | nuclear polyadenylation-dependent snRNA catabolic process |
| 3. B | GO:0004523 | RNA-DNA hybrid ribonuclease activity |
| 3. B | GO:0008907 | integrase activity |
| 3. B | GO:0003964 | RNA-directed DNA polymerase activity |
| 3. B | GO:0003887 | DNA-directed DNA polymerase activity |
| 3. B | GO:0071035 | nuclear polyadenylation-dependent rRNA catabolic process |
| 3. B | GO:0001171 | reverse transcription |
| 3. B | GO:0043657 | host cell |
| 3. B | GO:0039657 | suppression by virus of host gene expression |
| 3. B | GO:0015074 | DNA integration |
| 3. B | GO:0004533 | exoribonuclease H activity |
| 3. B | GO:0071038 | nuclear polyadenylation-dependent tRNA catabolic process |
| 3. B | GO:0043629 | ncRNA polyadenylation |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:0009117 | nucleotide metabolic process |
| 3. B | GO:0071031 | nuclear mRNA surveillance of mRNA 3'-end processing |
| 3. B | GO:0039651 | induction by virus of host cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0039604 | suppression by virus of host translation |
| 3. B | GO:0008289 | lipid binding |
| 3. B | GO:0071039 | nuclear polyadenylation-dependent CUT catabolic process |
| 3. B | GO:0004170 | dUTP diphosphatase activity |
| 3. B | GO:0031499 | TRAMP complex |
| 3. B | GO:0071036 | nuclear polyadenylation-dependent snoRNA catabolic process |
| 3. B | GO:0044826 | viral genome integration into host DNA |
| 3. B | GO:0075713 | establishment of integrated proviral latency |
| 3. B | GO:0006310 | DNA recombination |
| 3. B | GO:0003677 | DNA binding |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P18041 | Gag polyprotein | NA | 4.04e-13 | 2.87e-09 |
| 1. PB | Q77372 | Gag polyprotein | NA | 2.18e-14 | 6.66e-13 |
| 1. PB | P16087 | Gag polyprotein | NA | 4.94e-18 | 2.50e-12 |
| 1. PB | P19558 | Gag polyprotein | NA | 1.54e-20 | 4.77e-15 |
| 1. PB | P04592 | Gag polyprotein | NA | 7.00e-14 | 2.46e-14 |
| 1. PB | P33458 | Gag polyprotein | NA | 9.37e-20 | 7.96e-16 |
| 1. PB | Q9IDV8 | Gag polyprotein | NA | 9.50e-14 | 6.65e-14 |
| 1. PB | P0C209 | Gag polyprotein | NA | 2.21e-14 | 3.61e-05 |
| 1. PB | O12157 | Gag polyprotein | NA | 5.14e-12 | 2.87e-13 |
| 1. PB | P25058 | Gag polyprotein | NA | 1.01e-10 | 2.30e-08 |
| 1. PB | Q9YNA8 | Endogenous retrovirus group K member 19 Gag polyprotein | 1.73e-14 | 3.08e-108 | 0.0 |
| 1. PB | P05892 | Gag polyprotein | NA | 1.01e-12 | 2.64e-15 |
| 1. PB | P03345 | Gag polyprotein | NA | 4.82e-16 | 1.38e-04 |
| 1. PB | P0C776 | Gag polyprotein | NA | 6.10e-08 | 3.07e-08 |
| 1. PB | Q9QBZ6 | Gag polyprotein | NA | 8.50e-13 | 5.15e-14 |
| 1. PB | Q82850 | Gag polyprotein | NA | 1.31e-19 | 1.23e-12 |
| 1. PB | P03347 | Gag polyprotein | NA | 8.37e-13 | 1.40e-14 |
| 1. PB | P27978 | Gag polyprotein | NA | 2.45e-11 | 3.03e-14 |
| 1. PB | P14076 | Gag polyprotein | NA | 3.49e-15 | 4.56e-05 |
| 1. PB | Q1A250 | Gag polyprotein | NA | 1.45e-11 | 4.14e-14 |
| 1. PB | P04022 | Gag polyprotein | NA | 6.47e-45 | 3.59e-53 |
| 1. PB | P51516 | Gag polyprotein | NA | 2.59e-46 | 2.36e-51 |
| 1. PB | P05894 | Gag polyprotein | NA | 5.29e-12 | 1.89e-08 |
| 1. PB | P19504 | Gag polyprotein | NA | 5.88e-15 | 1.04e-09 |
| 1. PB | Q9QC00 | Gag polyprotein | NA | 5.44e-13 | 6.53e-16 |
| 1. PB | P12495 | Gag polyprotein | NA | 1.88e-15 | 4.04e-14 |
| 1. PB | P15832 | Gag polyprotein | NA | 5.38e-11 | 9.16e-10 |
| 1. PB | Q02843 | Gag polyprotein | NA | 1.66e-10 | 2.77e-13 |
| 1. PB | P03352 | Gag polyprotein | NA | 2.48e-17 | 1.70e-15 |
| 1. PB | P12496 | Gag polyprotein | NA | 1.98e-14 | 1.44e-10 |
| 1. PB | P63145 | Endogenous retrovirus group K member 24 Gag polyprotein | 1.22e-15 | 1.05e-115 | 0.0 |
| 1. PB | P62684 | Endogenous retrovirus group K member 113 Gag polyprotein | 5.66e-15 | 7.51e-119 | 0.0 |
| 1. PB | P03975 | IgE-binding protein | 2.61e-03 | 2.60e-03 | 1.57e-09 |
| 1. PB | P17282 | Gag polyprotein | NA | 1.28e-15 | 8.26e-15 |
| 1. PB | P05890 | Gag polyprotein | NA | 2.02e-14 | 9.11e-16 |
| 1. PB | P03348 | Gag polyprotein | NA | 1.42e-12 | 4.69e-15 |
| 1. PB | Q9WC53 | Gag polyprotein | NA | 8.88e-13 | 5.14e-14 |
| 1. PB | P24106 | Gag polyprotein | NA | 1.33e-10 | 8.63e-09 |
| 1. PB | P18095 | Gag polyprotein | NA | 3.09e-09 | 1.68e-07 |
| 1. PB | P04590 | Gag polyprotein | NA | 4.50e-10 | 3.09e-10 |
| 1. PB | P35962 | Gag polyprotein | NA | 1.89e-14 | 2.84e-15 |
| 1. PB | P21407 | Gag-Pro polyprotein | NA | 4.76e-02 | 2.48e-31 |
| 1. PB | Q74230 | Gag polyprotein | NA | 4.55e-11 | 2.05e-09 |
| 1. PB | P10258 | Gag polyprotein | NA | 5.81e-30 | 1.78e-54 |
| 1. PB | P24736 | Gag polyprotein | NA | 1.97e-12 | 1.02e-14 |
| 1. PB | P23425 | Gag polyprotein | NA | 2.60e-17 | 5.18e-15 |
| 1. PB | P20874 | Gag polyprotein | NA | 3.09e-12 | 1.18e-09 |
| 1. PB | Q05313 | Gag polyprotein | NA | 2.56e-17 | 1.35e-11 |
| 1. PB | P16900 | Gag polyprotein | NA | 1.86e-17 | 4.40e-14 |
| 1. PB | Q70622 | Gag polyprotein | NA | 1.26e-14 | 6.62e-15 |
| 1. PB | P14077 | Gag polyprotein | NA | 1.11e-15 | 1.19e-04 |
| 1. PB | Q79665 | Gag polyprotein | NA | 4.16e-15 | 3.42e-13 |
| 1. PB | P12450 | Gag polyprotein | NA | 1.31e-11 | 1.20e-06 |
| 1. PB | Q75001 | Gag polyprotein | NA | 3.79e-12 | 3.30e-14 |
| 1. PB | Q73367 | Gag polyprotein | NA | 1.45e-14 | 1.92e-14 |
| 1. PB | Q8AII2 | Gag polyprotein | NA | 1.68e-16 | 6.98e-16 |
| 1. PB | P05891 | Gag polyprotein | NA | 7.89e-13 | 8.02e-09 |
| 1. PB | P05887 | Gag polyprotein | NA | 3.44e-15 | 3.70e-15 |
| 1. PB | Q9Q721 | Gag polyprotein | NA | 1.44e-15 | 6.10e-14 |
| 1. PB | P69731 | Gag polyprotein | NA | 1.57e-09 | 5.25e-18 |
| 1. PB | P18800 | Gag polyprotein | NA | 4.55e-13 | 6.24e-14 |
| 1. PB | Q9HDB9 | Endogenous retrovirus group K member 5 Gag polyprotein | 8.27e-10 | 4.97e-76 | 0.0 |
| 1. PB | Q76633 | Gag polyprotein | NA | 1.51e-10 | 3.81e-10 |
| 1. PB | P12494 | Gag polyprotein | NA | 8.67e-14 | 3.15e-15 |
| 1. PB | Q9WC62 | Gag polyprotein | NA | 4.69e-13 | 4.92e-14 |
| 1. PB | P03349 | Gag polyprotein | NA | 1.07e-14 | 4.77e-15 |
| 1. PB | P03322 | Gag polyprotein | NA | 1.47e-09 | 1.01e-07 |
| 1. PB | P05888 | Gag polyprotein | NA | 9.26e-15 | 3.86e-15 |
| 1. PB | P19027 | Gag polyprotein | NA | 2.49e-20 | 2.04e-12 |
| 1. PB | P23424 | Gag polyprotein | NA | 1.43e-17 | 4.61e-15 |
| 1. PB | O89939 | Gag polyprotein | NA | 2.15e-12 | 1.19e-13 |
| 1. PB | Q9QBZ2 | Gag polyprotein | NA | 1.03e-13 | 6.29e-15 |
| 1. PB | P03346 | Gag polyprotein | NA | 1.89e-19 | 4.40e-05 |
| 1. PB | P63130 | Endogenous retrovirus group K member 7 Gag polyprotein | 3.00e-15 | 1.05e-99 | 0.0 |
| 1. PB | P11284 | Gag polyprotein | NA | 3.64e-28 | 5.47e-54 |
| 1. PB | P69730 | Gag polyprotein | NA | 1.57e-09 | 5.25e-18 |
| 1. PB | Q9QSR4 | Gag polyprotein | NA | 1.27e-11 | 6.33e-14 |
| 1. PB | Q74119 | Gag polyprotein | NA | 2.44e-10 | 8.85e-10 |
| 1. PB | P62685 | Endogenous retrovirus group K member 8 Gag polyprotein | 2.38e-14 | 2.02e-76 | 0.0 |
| 1. PB | P04593 | Gag polyprotein | NA | 1.03e-12 | 5.21e-15 |
| 1. PB | P04594 | Gag polyprotein | NA | 5.40e-17 | 4.02e-14 |
| 1. PB | P62683 | Endogenous retrovirus group K member 21 Gag polyprotein | 0 | 1.51e-136 | 0.0 |
| 1. PB | P22381 | Gag polyprotein | NA | 6.82e-07 | 9.17e-12 |
| 1. PB | P20889 | Gag polyprotein | NA | 5.66e-16 | 1.39e-14 |
| 1. PB | P87889 | Endogenous retrovirus group K member 10 Gag polyprotein | 1.78e-12 | 4.23e-105 | 0.0 |
| 1. PB | P35955 | Gag polyprotein | NA | 1.13e-17 | 5.12e-16 |
| 1. PB | Q7LDI9 | Endogenous retrovirus group K member 6 Gag polyprotein | 1.02e-12 | 2.15e-112 | 0.0 |
| 1. PB | P12493 | Gag polyprotein | NA | 1.13e-15 | 1.97e-14 |
| 1. PB | P04591 | Gag polyprotein | NA | 3.74e-14 | 1.16e-14 |
| 1. PB | P27972 | Gag polyprotein | NA | 1.74e-15 | 5.03e-15 |
| 1. PB | O91079 | Gag polyprotein | NA | 1.67e-12 | 6.38e-14 |
| 1. PB | P31622 | Gag polyprotein | NA | 2.55e-33 | 8.29e-47 |
| 1. PB | Q1A268 | Gag polyprotein | NA | 3.00e-12 | 1.45e-11 |
| 1. PB | P63126 | Endogenous retrovirus group K member 9 Gag polyprotein | 7.02e-13 | 3.28e-118 | 0.0 |
| 1. PB | Q09T00 | Gag polyprotein | NA | 2.83e-17 | 3.59e-05 |
| 1. PB | P69732 | Gag polyprotein | NA | 1.57e-09 | 5.25e-18 |
| 1. PB | P12498 | Gag-Pol polyprotein (Fragment) | NA | 1.50e-02 | 4.27e-15 |
| 1. PB | P04023 | Intracisternal A-particle Gag-related polyprotein | NA | 1.23e-17 | 7.58e-22 |
| 1. PB | P31634 | Gag polyprotein | NA | 1.65e-12 | 1.72e-09 |
| 1. PB | Q9QBY4 | Gag polyprotein | NA | 4.06e-11 | 4.36e-15 |
| 1. PB | P05893 | Gag polyprotein | NA | 9.15e-12 | 1.37e-08 |
| 1. PB | Q0R5R4 | Gag polyprotein | NA | 2.48e-17 | 1.50e-06 |
| 1. PB | O92954 | Gag polyprotein | NA | 9.55e-08 | 1.33e-07 |
| 1. PB | P05889 | Gag polyprotein (Fragment) | NA | 8.72e-10 | 4.54e-09 |
| 1. PB | P21411 | Gag polyprotein | NA | 1.28e-27 | 4.11e-35 |
| 1. PB | O93182 | Gag polyprotein | NA | 1.82e-13 | 1.39e-13 |
| 1. PB | P07567 | Gag polyprotein | NA | 1.15e-43 | 1.21e-51 |
| 1. PB | P31821 | Gag polyprotein | NA | 1.38e-17 | 1.42e-11 |
| 1. PB | P17756 | Gag polyprotein | NA | 6.03e-12 | 5.21e-09 |
| 1. PB | O89291 | Gag polyprotein | NA | 6.48e-12 | 2.21e-14 |
| 1. PB | P20873 | Gag polyprotein | NA | 4.87e-15 | 8.67e-15 |
| 1. PB | P0C1K7 | Gag polyprotein | NA | 3.30e-14 | 7.73e-12 |
| 2. P | P21435 | Gag polyprotein | NA | 6.48e-20 | NA |
| 2. P | Q8ND90 | Paraneoplastic antigen Ma1 | 2.88e-02 | 1.06e-02 | NA |
| 2. P | P29167 | Gag polyprotein | NA | 3.53e-19 | NA |
| 2. P | P0DOH4 | Glyco-Gag protein | NA | 2.15e-13 | NA |
| 2. P | P29168 | Gag polyprotein | NA | 1.21e-16 | NA |
| 2. P | Q8VHZ4 | Paraneoplastic antigen Ma1 homolog | 3.48e-02 | 1.05e-03 | NA |
| 2. P | P0DOH0 | Glyco-Gag protein | NA | 5.52e-15 | NA |
| 2. P | Q2F7I9 | Gag polyprotein | NA | 2.55e-18 | NA |
| 2. P | P26805 | Gag polyprotein | NA | 5.29e-18 | NA |
| 2. P | P03330 | Gag polyprotein | NA | 9.45e-17 | NA |
| 2. P | P32594 | Gag polyprotein | NA | 1.35e-07 | NA |
| 2. P | P27460 | Gag polyprotein | NA | 4.17e-18 | NA |
| 2. P | Q9TTC2 | Gag polyprotein | NA | 3.07e-18 | NA |
| 2. P | Q88937 | Gag polyprotein | NA | 4.64e-12 | NA |
| 2. P | P03340 | Gag polyprotein | NA | 1.44e-04 | NA |
| 2. P | Q8AWC3 | Activity-regulated cytoskeleton-associated protein | 2.07e-01 | 2.01e-05 | NA |
| 2. P | P0DOH6 | Glyco-Gag protein | NA | 4.36e-14 | NA |
| 2. P | Q87039 | Gag polyprotein | NA | 1.52e-03 | NA |
| 2. P | P27536 | Posterior protein | 3.16e-02 | 3.17e-03 | NA |
| 2. P | Q2KIT6 | Paraneoplastic antigen Ma2 homolog | 3.04e-02 | 1.82e-02 | NA |
| 2. P | Q27ID9 | Gag polyprotein | NA | 4.24e-18 | NA |
| 2. P | Q8C1C8 | Paraneoplastic antigen Ma1 homolog | 6.91e-02 | 8.17e-04 | NA |
| 2. P | P27400 | Gag polyprotein | NA | 3.93e-02 | NA |
| 2. P | P0DOH5 | Glyco-Gag protein | NA | 7.55e-13 | NA |
| 2. P | P26806 | Gag polyprotein | NA | 1.43e-18 | NA |
| 2. P | P03341 | Gag polyprotein | NA | 9.94e-16 | NA |
| 2. P | P03344 | Gag polyprotein | NA | 9.20e-08 | NA |
| 2. P | P26807 | Gag polyprotein | NA | 1.78e-18 | NA |
| 2. P | P0DOG8 | Glyco-Gag protein | NA | 2.35e-13 | NA |
| 2. P | Q7LC44 | Activity-regulated cytoskeleton-associated protein | 1.05e-01 | 3.97e-02 | NA |
| 2. P | Q9GMU3 | Paraneoplastic antigen Ma2 homolog | 2.57e-02 | 1.23e-03 | NA |
| 2. P | P03334 | Gag polyprotein | NA | 4.01e-17 | NA |
| 2. P | P21416 | Gag polyprotein | NA | 7.67e-18 | NA |
| 2. P | P0DOH2 | Glyco-Gag protein | NA | 1.66e-02 | NA |
| 2. P | P03332 | Gag polyprotein | NA | 1.14e-18 | NA |
| 2. P | P0DOH3 | Glyco-Gag protein | NA | 8.39e-12 | NA |
| 2. P | Q9ERH6 | Modulator of apoptosis 1 | 5.66e-02 | 3.97e-02 | NA |
| 2. P | A6QLK5 | Paraneoplastic antigen Ma1 homolog | 2.56e-02 | 5.12e-03 | NA |
| 2. P | Q5R486 | Paraneoplastic antigen Ma2 homolog | 3.24e-02 | 2.50e-02 | NA |
| 2. P | Q2F7J2 | Gag polyprotein | NA | 1.23e-17 | NA |
| 2. P | P03336 | Gag polyprotein | NA | 1.70e-19 | NA |
| 2. P | P10262 | Gag polyprotein | NA | 3.62e-14 | NA |
| 2. P | Q8UN02 | Glyco-Gag protein | NA | 3.01e-14 | NA |
| 2. P | P11269 | Gag polyprotein | NA | 4.42e-19 | NA |
| 2. P | P23090 | Gag polyprotein | NA | 2.03e-17 | NA |
| 2. P | Q8JZW8 | Paraneoplastic antigen Ma3 homolog | 1.56e-01 | 3.36e-03 | NA |
| 3. B | P19505 | Gag-Pol polyprotein | NA | NA | 1.48e-09 |
| 3. B | P03364 | Gag-Pro-Pol polyprotein | NA | NA | 9.73e-31 |
| 3. B | P27980 | Gag-Pol polyprotein | NA | NA | 2.49e-14 |
| 3. B | O41798 | Gag-Pol polyprotein | NA | NA | 2.46e-11 |
| 3. B | P35963 | Gag-Pol polyprotein | NA | NA | 6.05e-15 |
| 3. B | Q76634 | Gag-Pol polyprotein | NA | NA | 7.05e-10 |
| 3. B | Q9WC63 | Gag-Pol polyprotein | NA | NA | 6.62e-14 |
| 3. B | Q9Q720 | Gag-Pol polyprotein | NA | NA | 9.52e-13 |
| 3. B | P19560 | Gag-Pol polyprotein | NA | NA | 1.28e-13 |
| 3. B | Q73368 | Gag-Pol polyprotein | NA | NA | 6.19e-14 |
| 3. B | P03343 | Gag polyprotein (Fragment) | NA | NA | 2.50e-08 |
| 3. B | Q74120 | Gag-Pol polyprotein | NA | NA | 8.42e-10 |
| 3. B | P04589 | Gag-Pol polyprotein | NA | NA | 5.68e-14 |
| 3. B | Q9QBY3 | Gag-Pol polyprotein | NA | NA | 1.13e-14 |
| 3. B | P10271 | Gag-Pro polyprotein | NA | NA | 6.00e-54 |
| 3. B | P05961 | Gag-Pol polyprotein | NA | NA | 1.32e-14 |
| 3. B | P20892 | Gag-Pol polyprotein | NA | NA | 3.57e-14 |
| 3. B | Q82851 | Gag-Pol polyprotein | NA | NA | 3.74e-12 |
| 3. B | Q4U0X6 | Gag-Pro-Pol polyprotein | NA | NA | 1.55e-04 |
| 3. B | P20876 | Gag-Pol polyprotein | NA | NA | 1.93e-09 |
| 3. B | O89290 | Gag-Pol polyprotein | NA | NA | 4.86e-14 |
| 3. B | P03367 | Gag-Pol polyprotein | NA | NA | 1.16e-14 |
| 3. B | P03362 | Gag-Pro-Pol polyprotein | NA | NA | 1.97e-04 |
| 3. B | Q9IZT2 | Gag-Pro polyprotein | NA | NA | 1.66e-53 |
| 3. B | P23427 | Gag-Pol polyprotein | NA | NA | 1.52e-13 |
| 3. B | P14078 | Gag-Pro-Pol polyprotein | NA | NA | 8.70e-05 |
| 3. B | Q02836 | Gag-Pol polyprotein | NA | NA | 3.90e-13 |
| 3. B | P0DOI1 | Gag-Pro polyprotein | NA | NA | 7.80e-08 |
| 3. B | O76743 | ATP-dependent RNA helicase glh-4 | 8.55e-01 | NA | 0.025 |
| 3. B | O89940 | Gag-Pol polyprotein | NA | NA | 4.40e-13 |
| 3. B | P04587 | Gag-Pol polyprotein | NA | NA | 1.57e-14 |
| 3. B | O91080 | Gag-Pol polyprotein | NA | NA | 1.72e-13 |
| 3. B | P12451 | Gag-Pol polyprotein | NA | NA | 1.67e-06 |
| 3. B | P0C210 | Gag-Pro polyprotein | NA | NA | 4.43e-05 |
| 3. B | P04584 | Gag-Pol polyprotein | NA | NA | 6.78e-11 |
| 3. B | P11283 | Gag-Pro-Pol polyprotein | NA | NA | 7.67e-53 |
| 3. B | Q9QBZ9 | Gag-Pol polyprotein | NA | NA | 2.31e-15 |
| 3. B | P03370 | Gag-Pol polyprotein | NA | NA | 4.34e-14 |
| 3. B | P05895 | Gag-Pol polyprotein | NA | NA | 2.80e-14 |
| 3. B | P03353 | Gag-Pro polyprotein | NA | NA | 3.54e-05 |
| 3. B | P03354 | Gag-Pol polyprotein | NA | NA | 3.30e-07 |
| 3. B | P07572 | Gag-Pro-Pol polyprotein | NA | NA | 4.26e-44 |
| 3. B | Q1A267 | Gag-Pol polyprotein | NA | NA | 2.58e-10 |
| 3. B | Q0R5R3 | Gag-Pro polyprotein | NA | NA | 2.56e-06 |
| 3. B | P11365 | Intracisternal A-particle Gag-related polyprotein | NA | NA | 3.87e-30 |
| 3. B | P04588 | Gag-Pol polyprotein | NA | NA | 5.98e-14 |
| 3. B | P12502 | Gag-Pol polyprotein | NA | NA | 2.33e-10 |
| 3. B | P03361 | Gag-Pro-Pol polyprotein | NA | NA | 1.20e-04 |
| 3. B | P14074 | Gag-Pro polyprotein | NA | NA | 5.17e-05 |
| 3. B | P24740 | Gag-Pol polyprotein | NA | NA | 2.43e-14 |
| 3. B | P20875 | Gag-Pol polyprotein | NA | NA | 2.45e-14 |
| 3. B | Q12476 | Protein AIR2 | 6.06e-01 | NA | 0.035 |
| 3. B | P17757 | Gag-Pol polyprotein | NA | NA | 4.77e-09 |
| 3. B | P15833 | Gag-Pol polyprotein | NA | NA | 1.93e-09 |
| 3. B | P51517 | Gag-Pro-Pol polyprotein | NA | NA | 1.98e-43 |
| 3. B | P12497 | Gag-Pol polyprotein | NA | NA | 4.54e-14 |
| 3. B | P03369 | Gag-Pol polyprotein | NA | NA | 1.33e-14 |
| 3. B | P0C6F2 | Gag-Pol polyprotein | NA | NA | 1.34e-14 |
| 3. B | Q09SZ9 | Gag-Pro polyprotein | NA | NA | 4.33e-05 |
| 3. B | P31790 | Intracisternal A-particle Gag-related polyprotein | NA | NA | 3.52e-04 |
| 3. B | P51518 | Gag-Pro polyprotein | NA | NA | 2.23e-44 |
| 3. B | P35956 | Gag-Pol polyprotein | NA | NA | 1.59e-14 |
| 3. B | P05896 | Gag-Pol polyprotein | NA | NA | 2.37e-08 |
| 3. B | Q0R5R2 | Gag-Pro-Pol polyprotein | NA | NA | 1.54e-05 |
| 3. B | P03366 | Gag-Pol polyprotein | NA | NA | 3.64e-14 |
| 3. B | P03363 | Gag-Pro-Pol polyprotein | NA | NA | 6.03e-05 |
| 3. B | Q77373 | Gag-Pol polyprotein | NA | NA | 5.18e-13 |
| 3. B | Q89928 | Gag-Pol polyprotein | NA | NA | 5.28e-09 |
| 3. B | P18096 | Gag-Pol polyprotein | NA | NA | 1.05e-07 |
| 3. B | Q75002 | Gag-Pol polyprotein | NA | NA | 6.14e-14 |
| 3. B | P31625 | Gag-Pro polyprotein | NA | NA | 6.97e-42 |
| 3. B | P23426 | Gag-Pol polyprotein | NA | NA | 1.34e-13 |
| 3. B | O12158 | Gag-Pol polyprotein | NA | NA | 7.81e-13 |
| 3. B | P24107 | Gag-Pol polyprotein | NA | NA | 3.16e-09 |
| 3. B | P63128 | Endogenous retrovirus group K member 9 Pol protein | 4.83e-08 | NA | 0.0 |
| 3. B | Q9WC54 | Gag-Pol polyprotein | NA | NA | 4.39e-14 |
| 3. B | P25059 | Gag-Pro-Pol polyprotein | NA | NA | 4.07e-07 |
| 3. B | P03365 | Gag-Pro-Pol polyprotein | NA | NA | 2.13e-53 |
| 3. B | P22382 | Gag-Pol polyprotein | NA | NA | 1.90e-11 |
| 3. B | P0DOI0 | Gag-Pro polyprotein | NA | NA | 2.64e-05 |
| 3. B | Q9QSR3 | Gag-Pol polyprotein | NA | NA | 2.07e-13 |
| 3. B | Q9QBZ1 | Gag-Pol polyprotein | NA | NA | 1.91e-14 |
| 3. B | P27973 | Gag-Pol polyprotein | NA | NA | 5.22e-15 |
| 3. B | P17283 | Gag-Pol polyprotein | NA | NA | 3.14e-14 |
| 3. B | P05959 | Gag-Pol polyprotein | NA | NA | 1.70e-15 |
| 3. B | O92956 | Gag-Pol polyprotein | NA | NA | 3.11e-07 |
| 3. B | P40507 | Protein AIR1 | 6.96e-01 | NA | 0.035 |
| 3. B | Q9QBZ5 | Gag-Pol polyprotein | NA | NA | 1.14e-13 |
| 3. B | P04025 | Gag-Pro-Pol polyprotein | NA | NA | 1.87e-45 |
| 3. B | P04585 | Gag-Pol polyprotein | NA | NA | 2.81e-14 |
| 3. B | P31623 | Gag-Pro-Pol polyprotein | NA | NA | 2.01e-41 |
| 3. B | O93215 | Gag-Pol polyprotein | NA | NA | 2.94e-13 |
| 3. B | Q79666 | Gag-Pol polyprotein | NA | NA | 7.70e-13 |
| 3. B | P18042 | Gag-Pol polyprotein | NA | NA | 3.84e-10 |
| 3. B | P05960 | Gag-Pol polyprotein (Fragment) | NA | NA | 1.19e-14 |
| 3. B | Q9IDV9 | Gag-Pol polyprotein | NA | NA | 1.54e-13 |
| 3. B | Q04095 | Gag-Pol polyprotein | NA | NA | 8.23e-08 |
| 3. B | P18802 | Gag-Pol polyprotein | NA | NA | 2.27e-13 |
| 3. B | P07570 | Gag-Pro polyprotein | NA | NA | 4.73e-45 |
| 3. B | P10274 | Gag-Pro polyprotein | NA | NA | 1.19e-04 |
| 3. B | P05962 | Gag-Pol polyprotein | NA | NA | 1.12e-08 |
| 3. B | P0C211 | Gag-Pro-Pol polyprotein | NA | NA | 7.40e-05 |
| 3. B | P04024 | Gag-Pro polyprotein | NA | NA | 9.71e-47 |
| 3. B | P05897 | Gag-Pol polyprotein | NA | NA | 1.88e-08 |
| 3. B | Q8AII1 | Gag-Pol polyprotein | NA | NA | 8.67e-16 |
| 3. B | Q1A249 | Gag-Pol polyprotein | NA | NA | 5.74e-14 |
| 3. B | P12499 | Gag-Pol polyprotein | NA | NA | 1.37e-13 |