Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P87889
(Endogenous retrovirus group K member 10 Gag polyprotein) with a FATCAT P-Value: 1.78e-15 and RMSD of 3.09 angstrom. The sequence alignment identity is 94.0%.
Structural alignment shown in left. Query protein P62685 colored as red in alignment, homolog P87889 colored as blue.
Query protein P62685 is also shown in right top, homolog P87889 showed in right bottom. They are colored based on secondary structures.
P62685 MGQTKSKIKSKYASYLSFIKILLKRGGVKVSTKNLIKLFQIIEQFCPWFPEQGTLDLKDWKRIGKELKQAGRKGNIIPLTVWNDWAIIKAALEPFQTEED 100 P87889 MGQTKSKIKSKYASYLSFIKILLKRGGVKVSTKNLIKLFQIIEQFCPWFPEQGTSDLKDWKRIGKELKQAGRKGNIIPLTVWNDWAIIKAALEPFQTEED 100 P62685 SISVSDAPGSCLIDCNENTRKKSQKETESLHCEYVAEPVMAQSTQNVDYNQLQEVIYPETLKLEGKGPELVGPSESKPRGTSPLPAGQVPVTLQPQKQVK 200 P87889 SISVSDAPGSCLIDCNENTRKKSQKETESLHCEYVAEPVMAQSTQNVDYNQLQEVIYPETLKLEGKGPELMGPSESKPRGTSPLPAGQVLVRLQPQKQVK 200 P62685 ENKTQPPVAYQYWPPAELQYRPPPESQYGYPGMPPAPQGREPYPQPPTRRLNPTAPPSRQGSELHEIIDKSRKEGDTEAWQFPVTLEPMPPGEGAQEGEP 300 P87889 ENKTQPQVAYQYWPLAELQYRPPPESQYGYPGMPPAPQGRAPYHQPPTRRLNPMAPPSRQGSELHEIIDKSRKEGDTEAWQFPVTLEPMPPGEGAQEGEP 300 P62685 PTVEARYKSFSIKMLKDMKEGVKQYGPNSPYMRTLLDSIAHGHRLIPYDWEILAKSSLSPSQFLQFKTWWIDGVQEQVRRNRAANPPVNIDADQLLGIGQ 400 P87889 PTVEARYKSFSIKMLKDMKEGVKQYGPNSPYMRTLLDSIAYGHRLIPYDWEILAKSSLSPSQFLQFKTWWIDGVQEQVRRNRAANPPVNIDADQLLGIGQ 400 P62685 NWSTISQQALMQNEAIEQVRAICLRAWEKIQDPGSTCPSFNTVRQGSKEPYPDFVARLQDVAQKSIADEKARKVIVELMAYENANPECQSAIKPLKGKVP 500 P87889 NWSTISQQALMQNEAIEQVRAICLRAWEKIQDPGSTCPSFNTVRQGSKEPYPDFVARLQDVAQKSIADEKAGKVIVELMAYENANPECQSAIKPLKGKVP 500 P62685 AGSDVISEYVKACDGIGGAMHKAMLMAQAITGVVLGGQVRTFGGKCYNCGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQCRSKFD 600 P87889 AGSDVISEYVKACDGIGGAMHKAMLMAQAITGVVLGGQVRTFGGKCYNCGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQCRSKFD 600 P62685 KNGQPLSGNEQRGQPQAPQQTGAFPIQPFVPQGFQDNNPHCPKCFRE------------------- 647 P87889 KNGQPLSGNEQRGQPQAPQQTGAFPIQPFVPQGFQGQQPPLSQVFQGISQLPQYNNCPSPQAAVQQ 666
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005737 | cytoplasm |
| 1. PB | GO:0016032 | viral process |
| 1. PB | GO:0044196 | host cell nucleolus |
| 1. PB | GO:0008270 | zinc ion binding |
| 1. PB | GO:0016020 | membrane |
| 1. PB | GO:0030430 | host cell cytoplasm |
| 1. PB | GO:0019013 | viral nucleocapsid |
| 1. PB | GO:0004190 | aspartic-type endopeptidase activity |
| 1. PB | GO:0046797 | viral procapsid maturation |
| 1. PB | GO:0039702 | viral budding via host ESCRT complex |
| 1. PB | GO:0020002 | host cell plasma membrane |
| 1. PB | GO:0003676 | nucleic acid binding |
| 1. PB | GO:0042025 | host cell nucleus |
| 1. PB | GO:0005198 | structural molecule activity |
| 1. PB | GO:0044095 | host cell nucleoplasm |
| 1. PB | GO:0003723 | RNA binding |
| 1. PB | GO:0019028 | viral capsid |
| 1. PB | GO:0039660 | structural constituent of virion |
| 1. PB | GO:0055036 | virion membrane |
| 1. PB | GO:0072494 | host multivesicular body |
| 2. P | GO:0051260 | protein homooligomerization |
| 2. P | GO:1903561 | extracellular vesicle |
| 2. P | GO:0051028 | mRNA transport |
| 2. P | GO:0099149 | regulation of postsynaptic neurotransmitter receptor internalization |
| 2. P | GO:0007612 | learning |
| 2. P | GO:0016477 | cell migration |
| 2. P | GO:0050804 | modulation of chemical synaptic transmission |
| 2. P | GO:0015629 | actin cytoskeleton |
| 2. P | GO:1900452 | regulation of long-term synaptic depression |
| 2. P | GO:0022604 | regulation of cell morphogenesis |
| 2. P | GO:0043197 | dendritic spine |
| 2. P | GO:0120026 | host cell uropod |
| 2. P | GO:0045121 | membrane raft |
| 2. P | GO:0007492 | endoderm development |
| 2. P | GO:0044383 | host chromosome |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:0001844 | protein insertion into mitochondrial membrane involved in apoptotic signaling pathway |
| 2. P | GO:0008630 | intrinsic apoptotic signaling pathway in response to DNA damage |
| 2. P | GO:0019068 | virion assembly |
| 2. P | GO:0043065 | positive regulation of apoptotic process |
| 2. P | GO:0090200 | positive regulation of release of cytochrome c from mitochondria |
| 2. P | GO:0006897 | endocytosis |
| 2. P | GO:0098845 | postsynaptic endosome |
| 2. P | GO:2000969 | positive regulation of AMPA receptor activity |
| 2. P | GO:0075521 | microtubule-dependent intracellular transport of viral material towards nucleus |
| 2. P | GO:0007616 | long-term memory |
| 2. P | GO:0097190 | apoptotic signaling pathway |
| 2. P | GO:0002437 | inflammatory response to antigenic stimulus |
| 2. P | GO:0097192 | extrinsic apoptotic signaling pathway in absence of ligand |
| 2. P | GO:0098839 | postsynaptic density membrane |
| 2. P | GO:0071598 | neuronal ribonucleoprotein granule |
| 2. P | GO:0031901 | early endosome membrane |
| 2. P | GO:0001669 | acrosomal vesicle |
| 2. P | GO:0044185 | host cell late endosome membrane |
| 2. P | GO:0061001 | regulation of dendritic spine morphogenesis |
| 2. P | GO:0007010 | cytoskeleton organization |
| 2. P | GO:0009952 | anterior/posterior pattern specification |
| 2. P | GO:0008625 | extrinsic apoptotic signaling pathway via death domain receptors |
| 2. P | GO:0110077 | vesicle-mediated intercellular transport |
| 2. P | GO:0048168 | regulation of neuronal synaptic plasticity |
| 2. P | GO:0005730 | nucleolus |
| 2. P | GO:0005938 | cell cortex |
| 2. P | GO:1900271 | regulation of long-term synaptic potentiation |
| 3. B | GO:0046718 | viral entry into host cell |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0044823 | retroviral integrase activity |
| 3. B | GO:0075732 | viral penetration into host nucleus |
| 3. B | GO:0071037 | nuclear polyadenylation-dependent snRNA catabolic process |
| 3. B | GO:0004523 | RNA-DNA hybrid ribonuclease activity |
| 3. B | GO:0008907 | integrase activity |
| 3. B | GO:0003964 | RNA-directed DNA polymerase activity |
| 3. B | GO:0003887 | DNA-directed DNA polymerase activity |
| 3. B | GO:0071035 | nuclear polyadenylation-dependent rRNA catabolic process |
| 3. B | GO:0001171 | reverse transcription |
| 3. B | GO:0043657 | host cell |
| 3. B | GO:0039657 | suppression by virus of host gene expression |
| 3. B | GO:0015074 | DNA integration |
| 3. B | GO:0004533 | exoribonuclease H activity |
| 3. B | GO:0071038 | nuclear polyadenylation-dependent tRNA catabolic process |
| 3. B | GO:0043629 | ncRNA polyadenylation |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:0009117 | nucleotide metabolic process |
| 3. B | GO:0071031 | nuclear mRNA surveillance of mRNA 3'-end processing |
| 3. B | GO:0039651 | induction by virus of host cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0039604 | suppression by virus of host translation |
| 3. B | GO:0005634 | nucleus |
| 3. B | GO:0008289 | lipid binding |
| 3. B | GO:0071039 | nuclear polyadenylation-dependent CUT catabolic process |
| 3. B | GO:0004170 | dUTP diphosphatase activity |
| 3. B | GO:0031499 | TRAMP complex |
| 3. B | GO:0071036 | nuclear polyadenylation-dependent snoRNA catabolic process |
| 3. B | GO:0044826 | viral genome integration into host DNA |
| 3. B | GO:0075713 | establishment of integrated proviral latency |
| 3. B | GO:0006310 | DNA recombination |
| 3. B | GO:0003677 | DNA binding |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P18041 | Gag polyprotein | NA | 1.61e-07 | 5.48e-10 |
| 1. PB | Q77372 | Gag polyprotein | NA | 3.46e-10 | 1.80e-13 |
| 1. PB | P16087 | Gag polyprotein | NA | 8.91e-17 | 4.59e-13 |
| 1. PB | P19558 | Gag polyprotein | NA | 2.11e-16 | 4.63e-16 |
| 1. PB | P04592 | Gag polyprotein | NA | 1.11e-11 | 5.54e-15 |
| 1. PB | P33458 | Gag polyprotein | NA | 2.15e-19 | 5.35e-15 |
| 1. PB | Q9IDV8 | Gag polyprotein | NA | 1.40e-09 | 1.32e-14 |
| 1. PB | P0C209 | Gag polyprotein | NA | 3.51e-15 | 8.16e-06 |
| 1. PB | O12157 | Gag polyprotein | NA | 1.28e-09 | 7.36e-14 |
| 1. PB | P25058 | Gag polyprotein | NA | 3.80e-10 | 5.15e-10 |
| 1. PB | Q9YNA8 | Endogenous retrovirus group K member 19 Gag polyprotein | 5.98e-13 | 1.46e-73 | 0.0 |
| 1. PB | P05892 | Gag polyprotein | NA | 1.26e-09 | 7.33e-16 |
| 1. PB | P03345 | Gag polyprotein | NA | 3.15e-16 | 2.76e-05 |
| 1. PB | P0C776 | Gag polyprotein | NA | 3.53e-06 | 2.20e-09 |
| 1. PB | Q9QBZ6 | Gag polyprotein | NA | 3.95e-09 | 1.41e-14 |
| 1. PB | Q82850 | Gag polyprotein | NA | 5.06e-16 | 1.49e-13 |
| 1. PB | P03347 | Gag polyprotein | NA | 6.50e-09 | 3.15e-15 |
| 1. PB | P27978 | Gag polyprotein | NA | 9.16e-09 | 7.82e-15 |
| 1. PB | P14076 | Gag polyprotein | NA | 2.74e-15 | 9.38e-06 |
| 1. PB | Q1A250 | Gag polyprotein | NA | 3.01e-09 | 1.07e-14 |
| 1. PB | P04022 | Gag polyprotein | NA | 1.45e-47 | 3.13e-55 |
| 1. PB | P51516 | Gag polyprotein | NA | 1.74e-46 | 6.87e-53 |
| 1. PB | P05894 | Gag polyprotein | NA | 3.09e-09 | 3.93e-09 |
| 1. PB | P19504 | Gag polyprotein | NA | 1.02e-11 | 1.70e-10 |
| 1. PB | Q9QC00 | Gag polyprotein | NA | 2.58e-10 | 1.80e-16 |
| 1. PB | P12495 | Gag polyprotein | NA | 1.21e-12 | 7.38e-15 |
| 1. PB | P15832 | Gag polyprotein | NA | 3.23e-06 | 1.79e-10 |
| 1. PB | Q02843 | Gag polyprotein | NA | 1.55e-07 | 7.77e-14 |
| 1. PB | P03352 | Gag polyprotein | NA | 4.38e-17 | 9.19e-15 |
| 1. PB | P12496 | Gag polyprotein | NA | 4.24e-12 | 2.96e-11 |
| 1. PB | P63145 | Endogenous retrovirus group K member 24 Gag polyprotein | 7.44e-14 | 2.55e-75 | 0.0 |
| 1. PB | P62684 | Endogenous retrovirus group K member 113 Gag polyprotein | 3.66e-15 | 8.51e-76 | 0.0 |
| 1. PB | P03975 | IgE-binding protein | 4.46e-05 | 4.12e-02 | 6.80e-11 |
| 1. PB | P17282 | Gag polyprotein | NA | 7.38e-13 | 2.01e-15 |
| 1. PB | P05890 | Gag polyprotein | NA | 3.23e-11 | 1.69e-16 |
| 1. PB | P03348 | Gag polyprotein | NA | 1.46e-08 | 1.04e-15 |
| 1. PB | Q9WC53 | Gag polyprotein | NA | 4.96e-10 | 1.26e-14 |
| 1. PB | P24106 | Gag polyprotein | NA | 3.74e-06 | 1.74e-09 |
| 1. PB | P18095 | Gag polyprotein | NA | 3.69e-05 | 2.98e-08 |
| 1. PB | P04590 | Gag polyprotein | NA | 6.95e-06 | 5.99e-11 |
| 1. PB | P35962 | Gag polyprotein | NA | 4.37e-11 | 6.08e-16 |
| 1. PB | Q74230 | Gag polyprotein | NA | 5.68e-06 | 3.78e-10 |
| 1. PB | P10258 | Gag polyprotein | NA | 1.17e-41 | 4.16e-55 |
| 1. PB | P24736 | Gag polyprotein | NA | 1.19e-08 | 2.86e-15 |
| 1. PB | P23425 | Gag polyprotein | NA | 2.92e-17 | 2.80e-14 |
| 1. PB | P20874 | Gag polyprotein | NA | 1.41e-08 | 2.27e-10 |
| 1. PB | Q05313 | Gag polyprotein | NA | 5.65e-16 | 1.96e-12 |
| 1. PB | P16900 | Gag polyprotein | NA | 3.55e-17 | 2.56e-13 |
| 1. PB | Q70622 | Gag polyprotein | NA | 4.61e-11 | 1.37e-15 |
| 1. PB | P14077 | Gag polyprotein | NA | 5.06e-16 | 2.36e-05 |
| 1. PB | Q79665 | Gag polyprotein | NA | 3.46e-11 | 7.03e-14 |
| 1. PB | P12450 | Gag polyprotein | NA | 2.19e-06 | 1.83e-07 |
| 1. PB | Q75001 | Gag polyprotein | NA | 8.71e-09 | 8.14e-15 |
| 1. PB | Q73367 | Gag polyprotein | NA | 5.08e-11 | 6.50e-15 |
| 1. PB | Q8AII2 | Gag polyprotein | NA | 2.58e-13 | 1.65e-16 |
| 1. PB | P05891 | Gag polyprotein | NA | 2.02e-08 | 1.79e-09 |
| 1. PB | P05887 | Gag polyprotein | NA | 1.68e-11 | 1.20e-15 |
| 1. PB | Q9Q721 | Gag polyprotein | NA | 8.40e-13 | 8.99e-14 |
| 1. PB | P69731 | Gag polyprotein | NA | 3.42e-05 | 8.09e-19 |
| 1. PB | P18800 | Gag polyprotein | NA | 8.30e-10 | 1.21e-14 |
| 1. PB | Q9HDB9 | Endogenous retrovirus group K member 5 Gag polyprotein | 4.86e-08 | 5.19e-70 | 0.0 |
| 1. PB | Q76633 | Gag polyprotein | NA | 2.04e-06 | 6.03e-11 |
| 1. PB | P12494 | Gag polyprotein | NA | 2.87e-10 | 6.59e-16 |
| 1. PB | Q9WC62 | Gag polyprotein | NA | 1.59e-10 | 1.16e-14 |
| 1. PB | P03349 | Gag polyprotein | NA | 8.84e-12 | 9.89e-16 |
| 1. PB | P03322 | Gag polyprotein | NA | 2.20e-07 | 6.51e-09 |
| 1. PB | P05888 | Gag polyprotein | NA | 2.59e-11 | 7.33e-16 |
| 1. PB | P19027 | Gag polyprotein | NA | 4.45e-19 | 3.49e-13 |
| 1. PB | P23424 | Gag polyprotein | NA | 1.91e-17 | 2.61e-14 |
| 1. PB | O89939 | Gag polyprotein | NA | 1.05e-10 | 3.20e-14 |
| 1. PB | Q9QBZ2 | Gag polyprotein | NA | 9.91e-11 | 1.24e-15 |
| 1. PB | P03346 | Gag polyprotein | NA | 1.33e-19 | 8.59e-06 |
| 1. PB | P63130 | Endogenous retrovirus group K member 7 Gag polyprotein | 1.05e-14 | 3.39e-68 | 0.0 |
| 1. PB | P11284 | Gag polyprotein | NA | 8.09e-40 | 5.24e-55 |
| 1. PB | P69730 | Gag polyprotein | NA | 3.42e-05 | 8.09e-19 |
| 1. PB | Q9QSR4 | Gag polyprotein | NA | 9.98e-10 | 1.38e-14 |
| 1. PB | Q74119 | Gag polyprotein | NA | 1.08e-06 | 1.78e-10 |
| 1. PB | P62685 | Endogenous retrovirus group K member 8 Gag polyprotein | 0 | 9.06e-135 | 0.0 |
| 1. PB | P04593 | Gag polyprotein | NA | 1.46e-08 | 1.19e-15 |
| 1. PB | P04594 | Gag polyprotein | NA | 2.77e-13 | 9.66e-15 |
| 1. PB | P62683 | Endogenous retrovirus group K member 21 Gag polyprotein | 4.10e-14 | 3.31e-76 | 0.0 |
| 1. PB | P22381 | Gag polyprotein | NA | 6.66e-05 | 2.02e-12 |
| 1. PB | P20889 | Gag polyprotein | NA | 7.48e-13 | 2.87e-15 |
| 1. PB | P87889 | Endogenous retrovirus group K member 10 Gag polyprotein | 1.78e-15 | 1.21e-69 | 0.0 |
| 1. PB | P35955 | Gag polyprotein | NA | 1.68e-17 | 2.45e-15 |
| 1. PB | Q7LDI9 | Endogenous retrovirus group K member 6 Gag polyprotein | 7.26e-13 | 1.58e-72 | 0.0 |
| 1. PB | P12493 | Gag polyprotein | NA | 1.66e-12 | 4.48e-15 |
| 1. PB | P04591 | Gag polyprotein | NA | 1.37e-10 | 2.86e-15 |
| 1. PB | P27972 | Gag polyprotein | NA | 4.49e-11 | 1.48e-15 |
| 1. PB | O91079 | Gag polyprotein | NA | 1.18e-08 | 1.18e-14 |
| 1. PB | P31622 | Gag polyprotein | NA | 7.96e-31 | 8.94e-49 |
| 1. PB | Q1A268 | Gag polyprotein | NA | 8.49e-09 | 3.22e-12 |
| 1. PB | P63126 | Endogenous retrovirus group K member 9 Gag polyprotein | 5.00e-13 | 1.82e-76 | 0.0 |
| 1. PB | Q09T00 | Gag polyprotein | NA | 4.67e-17 | 2.58e-06 |
| 1. PB | P69732 | Gag polyprotein | NA | 3.42e-05 | 8.09e-19 |
| 1. PB | P04023 | Intracisternal A-particle Gag-related polyprotein | NA | 3.10e-16 | 1.99e-23 |
| 1. PB | P31634 | Gag polyprotein | NA | 1.66e-09 | 3.34e-10 |
| 1. PB | Q9QBY4 | Gag polyprotein | NA | 1.48e-08 | 1.18e-15 |
| 1. PB | P05893 | Gag polyprotein | NA | 4.10e-09 | 2.15e-08 |
| 1. PB | Q0R5R4 | Gag polyprotein | NA | 4.38e-17 | 1.13e-07 |
| 1. PB | O92954 | Gag polyprotein | NA | 5.94e-06 | 8.87e-09 |
| 1. PB | P05889 | Gag polyprotein (Fragment) | NA | 3.33e-12 | 7.19e-10 |
| 1. PB | P21411 | Gag polyprotein | NA | 1.26e-28 | 1.52e-36 |
| 1. PB | O93182 | Gag polyprotein | NA | 1.27e-10 | 3.26e-14 |
| 1. PB | P07567 | Gag polyprotein | NA | 4.49e-46 | 1.14e-53 |
| 1. PB | P31821 | Gag polyprotein | NA | 1.57e-17 | 2.27e-12 |
| 1. PB | O89291 | Gag polyprotein | NA | 1.75e-09 | 4.97e-15 |
| 1. PB | P17756 | Gag polyprotein | NA | 5.06e-07 | 9.63e-10 |
| 1. PB | P20873 | Gag polyprotein | NA | 1.99e-11 | 1.98e-15 |
| 1. PB | P0C1K7 | Gag polyprotein | NA | 9.22e-12 | 2.03e-12 |
| 2. P | P21435 | Gag polyprotein | NA | 6.33e-22 | NA |
| 2. P | Q8ND90 | Paraneoplastic antigen Ma1 | 3.44e-02 | 6.88e-03 | NA |
| 2. P | P29167 | Gag polyprotein | NA | 7.21e-21 | NA |
| 2. P | P0DOH4 | Glyco-Gag protein | NA | 4.58e-20 | NA |
| 2. P | P29168 | Gag polyprotein | NA | 6.80e-19 | NA |
| 2. P | Q8VHZ4 | Paraneoplastic antigen Ma1 homolog | 4.71e-02 | 2.16e-03 | NA |
| 2. P | Q9UL42 | Paraneoplastic antigen Ma2 | 3.42e-02 | 1.01e-02 | NA |
| 2. P | P0DOH0 | Glyco-Gag protein | NA | 3.82e-21 | NA |
| 2. P | Q2F7I9 | Gag polyprotein | NA | 4.82e-20 | NA |
| 2. P | P26805 | Gag polyprotein | NA | 2.72e-19 | NA |
| 2. P | P03330 | Gag polyprotein | NA | 3.55e-17 | NA |
| 2. P | Q63053 | Activity-regulated cytoskeleton-associated protein | 4.77e-02 | 2.38e-03 | NA |
| 2. P | Q9WV31 | Activity-regulated cytoskeleton-associated protein | 5.15e-02 | 1.36e-02 | NA |
| 2. P | P32594 | Gag polyprotein | NA | 3.38e-12 | NA |
| 2. P | P27460 | Gag polyprotein | NA | 2.15e-19 | NA |
| 2. P | Q9TTC2 | Gag polyprotein | NA | 5.01e-19 | NA |
| 2. P | Q88937 | Gag polyprotein | NA | 3.28e-10 | NA |
| 2. P | P03340 | Gag polyprotein | NA | 8.89e-08 | NA |
| 2. P | Q8AWC3 | Activity-regulated cytoskeleton-associated protein | 8.25e-02 | 6.72e-06 | NA |
| 2. P | P0DOH6 | Glyco-Gag protein | NA | 1.64e-20 | NA |
| 2. P | Q2KIT6 | Paraneoplastic antigen Ma2 homolog | 2.56e-02 | 4.94e-03 | NA |
| 2. P | Q87039 | Gag polyprotein | NA | 5.75e-03 | NA |
| 2. P | Q27ID9 | Gag polyprotein | NA | 3.53e-20 | NA |
| 2. P | Q8C1C8 | Paraneoplastic antigen Ma1 homolog | 4.24e-02 | 1.07e-03 | NA |
| 2. P | P0DOH5 | Glyco-Gag protein | NA | 2.30e-19 | NA |
| 2. P | P26806 | Gag polyprotein | NA | 1.55e-19 | NA |
| 2. P | P03341 | Gag polyprotein | NA | 1.58e-21 | NA |
| 2. P | P03344 | Gag polyprotein | NA | 1.03e-06 | NA |
| 2. P | P26807 | Gag polyprotein | NA | 3.47e-20 | NA |
| 2. P | P0DOG8 | Glyco-Gag protein | NA | 1.73e-20 | NA |
| 2. P | Q8N8U3 | Retrotransposon Gag-like protein 3 | 1.91e-01 | 9.56e-03 | NA |
| 2. P | Q7LC44 | Activity-regulated cytoskeleton-associated protein | 4.41e-02 | 2.23e-04 | NA |
| 2. P | Q9GMU3 | Paraneoplastic antigen Ma2 homolog | 2.16e-02 | 3.19e-04 | NA |
| 2. P | P03334 | Gag polyprotein | NA | 4.61e-19 | NA |
| 2. P | P21416 | Gag polyprotein | NA | 5.07e-20 | NA |
| 2. P | P0DOH2 | Glyco-Gag protein | NA | 1.80e-05 | NA |
| 2. P | P03332 | Gag polyprotein | NA | 7.68e-20 | NA |
| 2. P | P0DOH3 | Glyco-Gag protein | NA | 2.02e-18 | NA |
| 2. P | Q9ERH6 | Modulator of apoptosis 1 | 4.14e-02 | 9.38e-03 | NA |
| 2. P | Q8BHK0 | Paraneoplastic antigen Ma2 homolog | 1.86e-02 | 1.30e-02 | NA |
| 2. P | A6QLK5 | Paraneoplastic antigen Ma1 homolog | 3.90e-02 | 1.10e-02 | NA |
| 2. P | Q5R486 | Paraneoplastic antigen Ma2 homolog | 2.69e-02 | 5.43e-03 | NA |
| 2. P | Q2F7J2 | Gag polyprotein | NA | 3.59e-20 | NA |
| 2. P | P03336 | Gag polyprotein | NA | 3.44e-21 | NA |
| 2. P | P10262 | Gag polyprotein | NA | 2.77e-19 | NA |
| 2. P | Q96BY2 | Modulator of apoptosis 1 | 4.73e-02 | 2.90e-02 | NA |
| 2. P | Q8UN02 | Glyco-Gag protein | NA | 7.81e-20 | NA |
| 2. P | P11269 | Gag polyprotein | NA | 6.84e-21 | NA |
| 2. P | P23090 | Gag polyprotein | NA | 4.69e-19 | NA |
| 3. B | P19505 | Gag-Pol polyprotein | NA | NA | 2.20e-10 |
| 3. B | P03364 | Gag-Pro-Pol polyprotein | NA | NA | 2.44e-32 |
| 3. B | P27980 | Gag-Pol polyprotein | NA | NA | 6.57e-15 |
| 3. B | O41798 | Gag-Pol polyprotein | NA | NA | 6.86e-12 |
| 3. B | P35963 | Gag-Pol polyprotein | NA | NA | 1.44e-15 |
| 3. B | Q76634 | Gag-Pol polyprotein | NA | NA | 1.29e-10 |
| 3. B | Q9WC63 | Gag-Pol polyprotein | NA | NA | 1.39e-14 |
| 3. B | Q9Q720 | Gag-Pol polyprotein | NA | NA | 1.94e-13 |
| 3. B | P19560 | Gag-Pol polyprotein | NA | NA | 1.88e-14 |
| 3. B | Q73368 | Gag-Pol polyprotein | NA | NA | 1.49e-14 |
| 3. B | P03343 | Gag polyprotein (Fragment) | NA | NA | 0.001 |
| 3. B | Q74120 | Gag-Pol polyprotein | NA | NA | 1.65e-10 |
| 3. B | P04589 | Gag-Pol polyprotein | NA | NA | 1.28e-14 |
| 3. B | Q9QBY3 | Gag-Pol polyprotein | NA | NA | 2.71e-15 |
| 3. B | P10271 | Gag-Pro polyprotein | NA | NA | 1.44e-54 |
| 3. B | P05961 | Gag-Pol polyprotein | NA | NA | 2.86e-15 |
| 3. B | P20892 | Gag-Pol polyprotein | NA | NA | 7.17e-15 |
| 3. B | Q82851 | Gag-Pol polyprotein | NA | NA | 5.19e-13 |
| 3. B | Q4U0X6 | Gag-Pro-Pol polyprotein | NA | NA | 2.68e-05 |
| 3. B | P20876 | Gag-Pol polyprotein | NA | NA | 3.65e-10 |
| 3. B | O89290 | Gag-Pol polyprotein | NA | NA | 1.20e-14 |
| 3. B | P03367 | Gag-Pol polyprotein | NA | NA | 2.68e-15 |
| 3. B | P03362 | Gag-Pro-Pol polyprotein | NA | NA | 4.08e-05 |
| 3. B | Q9IZT2 | Gag-Pro polyprotein | NA | NA | 3.81e-54 |
| 3. B | P23427 | Gag-Pol polyprotein | NA | NA | 5.09e-13 |
| 3. B | P14078 | Gag-Pro-Pol polyprotein | NA | NA | 1.90e-05 |
| 3. B | Q02836 | Gag-Pol polyprotein | NA | NA | 9.50e-14 |
| 3. B | P0DOI1 | Gag-Pro polyprotein | NA | NA | 2.34e-09 |
| 3. B | O76743 | ATP-dependent RNA helicase glh-4 | 6.99e-01 | NA | 0.032 |
| 3. B | O89940 | Gag-Pol polyprotein | NA | NA | 1.21e-13 |
| 3. B | P04587 | Gag-Pol polyprotein | NA | NA | 3.46e-15 |
| 3. B | O91080 | Gag-Pol polyprotein | NA | NA | 3.29e-14 |
| 3. B | P12451 | Gag-Pol polyprotein | NA | NA | 3.42e-07 |
| 3. B | P0C210 | Gag-Pro polyprotein | NA | NA | 9.52e-06 |
| 3. B | P04584 | Gag-Pol polyprotein | NA | NA | 1.11e-11 |
| 3. B | P11283 | Gag-Pro-Pol polyprotein | NA | NA | 1.75e-53 |
| 3. B | Q9QBZ9 | Gag-Pol polyprotein | NA | NA | 6.02e-16 |
| 3. B | P03370 | Gag-Pol polyprotein | NA | NA | 2.14e-13 |
| 3. B | P05895 | Gag-Pol polyprotein | NA | NA | 7.41e-15 |
| 3. B | P03353 | Gag-Pro polyprotein | NA | NA | 9.42e-06 |
| 3. B | P03354 | Gag-Pol polyprotein | NA | NA | 1.62e-08 |
| 3. B | P21407 | Gag-Pro polyprotein | NA | NA | 7.87e-33 |
| 3. B | P07572 | Gag-Pro-Pol polyprotein | NA | NA | 6.93e-46 |
| 3. B | Q1A267 | Gag-Pol polyprotein | NA | NA | 6.03e-11 |
| 3. B | Q0R5R3 | Gag-Pro polyprotein | NA | NA | 1.93e-07 |
| 3. B | P11365 | Intracisternal A-particle Gag-related polyprotein | NA | NA | 2.83e-30 |
| 3. B | P04588 | Gag-Pol polyprotein | NA | NA | 1.61e-14 |
| 3. B | P12502 | Gag-Pol polyprotein | NA | NA | 3.94e-11 |
| 3. B | P03361 | Gag-Pro-Pol polyprotein | NA | NA | 3.58e-06 |
| 3. B | P14074 | Gag-Pro polyprotein | NA | NA | 1.07e-05 |
| 3. B | P24740 | Gag-Pol polyprotein | NA | NA | 5.68e-15 |
| 3. B | P20875 | Gag-Pol polyprotein | NA | NA | 5.69e-15 |
| 3. B | Q12476 | Protein AIR2 | 4.74e-01 | NA | 0.041 |
| 3. B | P17757 | Gag-Pol polyprotein | NA | NA | 8.51e-10 |
| 3. B | P15833 | Gag-Pol polyprotein | NA | NA | 3.44e-10 |
| 3. B | P51517 | Gag-Pro-Pol polyprotein | NA | NA | 4.21e-45 |
| 3. B | P12497 | Gag-Pol polyprotein | NA | NA | 1.11e-14 |
| 3. B | P03369 | Gag-Pol polyprotein | NA | NA | 3.04e-15 |
| 3. B | P0C6F2 | Gag-Pol polyprotein | NA | NA | 3.17e-15 |
| 3. B | Q09SZ9 | Gag-Pro polyprotein | NA | NA | 3.27e-06 |
| 3. B | P31790 | Intracisternal A-particle Gag-related polyprotein | NA | NA | 2.61e-04 |
| 3. B | P51518 | Gag-Pro polyprotein | NA | NA | 3.73e-46 |
| 3. B | P35956 | Gag-Pol polyprotein | NA | NA | 7.84e-14 |
| 3. B | P05896 | Gag-Pol polyprotein | NA | NA | 4.46e-09 |
| 3. B | Q0R5R2 | Gag-Pro-Pol polyprotein | NA | NA | 1.20e-06 |
| 3. B | P03366 | Gag-Pol polyprotein | NA | NA | 9.07e-15 |
| 3. B | P03363 | Gag-Pro-Pol polyprotein | NA | NA | 1.36e-05 |
| 3. B | Q77373 | Gag-Pol polyprotein | NA | NA | 1.33e-13 |
| 3. B | Q89928 | Gag-Pol polyprotein | NA | NA | 8.09e-10 |
| 3. B | P18096 | Gag-Pol polyprotein | NA | NA | 1.77e-08 |
| 3. B | Q75002 | Gag-Pol polyprotein | NA | NA | 1.74e-14 |
| 3. B | P31625 | Gag-Pro polyprotein | NA | NA | 1.85e-43 |
| 3. B | P23426 | Gag-Pol polyprotein | NA | NA | 6.52e-13 |
| 3. B | O12158 | Gag-Pol polyprotein | NA | NA | 2.20e-13 |
| 3. B | P24107 | Gag-Pol polyprotein | NA | NA | 5.41e-10 |
| 3. B | P63128 | Endogenous retrovirus group K member 9 Pol protein | 3.06e-04 | NA | 0.0 |
| 3. B | Q9WC54 | Gag-Pol polyprotein | NA | NA | 1.09e-14 |
| 3. B | P25059 | Gag-Pro-Pol polyprotein | NA | NA | 9.33e-09 |
| 3. B | P03365 | Gag-Pro-Pol polyprotein | NA | NA | 6.45e-54 |
| 3. B | P22382 | Gag-Pol polyprotein | NA | NA | 4.32e-12 |
| 3. B | P0DOI0 | Gag-Pro polyprotein | NA | NA | 1.14e-06 |
| 3. B | Q9QSR3 | Gag-Pol polyprotein | NA | NA | 4.50e-14 |
| 3. B | Q9QBZ1 | Gag-Pol polyprotein | NA | NA | 3.70e-15 |
| 3. B | P27973 | Gag-Pol polyprotein | NA | NA | 1.62e-15 |
| 3. B | P17283 | Gag-Pol polyprotein | NA | NA | 7.09e-15 |
| 3. B | P05959 | Gag-Pol polyprotein | NA | NA | 4.20e-16 |
| 3. B | O92956 | Gag-Pol polyprotein | NA | NA | 1.71e-08 |
| 3. B | P40507 | Protein AIR1 | 7.19e-01 | NA | 0.036 |
| 3. B | P12498 | Gag-Pol polyprotein (Fragment) | NA | NA | 8.90e-16 |
| 3. B | Q9QBZ5 | Gag-Pol polyprotein | NA | NA | 3.06e-14 |
| 3. B | P04025 | Gag-Pro-Pol polyprotein | NA | NA | 2.75e-59 |
| 3. B | P04585 | Gag-Pol polyprotein | NA | NA | 6.58e-15 |
| 3. B | P31623 | Gag-Pro-Pol polyprotein | NA | NA | 3.00e-43 |
| 3. B | O93215 | Gag-Pol polyprotein | NA | NA | 6.75e-14 |
| 3. B | Q79666 | Gag-Pol polyprotein | NA | NA | 1.58e-13 |
| 3. B | P18042 | Gag-Pol polyprotein | NA | NA | 7.13e-11 |
| 3. B | P05960 | Gag-Pol polyprotein (Fragment) | NA | NA | 2.36e-15 |
| 3. B | Q9IDV9 | Gag-Pol polyprotein | NA | NA | 3.43e-14 |
| 3. B | Q04095 | Gag-Pol polyprotein | NA | NA | 4.51e-09 |
| 3. B | P18802 | Gag-Pol polyprotein | NA | NA | 4.06e-14 |
| 3. B | P07570 | Gag-Pro polyprotein | NA | NA | 8.64e-47 |
| 3. B | P10274 | Gag-Pro polyprotein | NA | NA | 2.63e-05 |
| 3. B | P05962 | Gag-Pol polyprotein | NA | NA | 2.61e-09 |
| 3. B | P0C211 | Gag-Pro-Pol polyprotein | NA | NA | 1.63e-05 |
| 3. B | P04024 | Gag-Pro polyprotein | NA | NA | 2.01e-48 |
| 3. B | P05897 | Gag-Pol polyprotein | NA | NA | 3.01e-09 |
| 3. B | Q8AII1 | Gag-Pol polyprotein | NA | NA | 1.79e-16 |
| 3. B | Q1A249 | Gag-Pol polyprotein | NA | NA | 1.45e-14 |
| 3. B | P12499 | Gag-Pol polyprotein | NA | NA | 2.60e-14 |