Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P63093
(Guanine nucleotide-binding protein G(s) subunit alpha) with a FATCAT P-Value: 0.0 and RMSD of 1.14 angstrom. The sequence alignment identity is 99.7%.
Structural alignment shown in left. Query protein P63092 colored as red in alignment, homolog P63093 colored as blue.
Query protein P63092 is also shown in right top, homolog P63093 showed in right bottom. They are colored based on secondary structures.
P63092 MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLK 100 P63093 MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLK 100 P63092 EAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRC 200 P63093 EAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPNFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRC 200 P63092 RVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEK 300 P63093 RVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEK 300 P63092 VLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL 394 P63093 VLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL 394
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005768 | endosome |
| 1. PB | GO:0005159 | insulin-like growth factor receptor binding |
| 1. PB | GO:1903665 | negative regulation of asexual reproduction |
| 1. PB | GO:0060789 | hair follicle placode formation |
| 1. PB | GO:0019904 | protein domain specific binding |
| 1. PB | GO:0003380 | establishment or maintenance of cytoskeleton polarity involved in gastrulation |
| 1. PB | GO:0043267 | negative regulation of potassium ion transport |
| 1. PB | GO:0042733 | embryonic digit morphogenesis |
| 1. PB | GO:0031821 | G protein-coupled serotonin receptor binding |
| 1. PB | GO:0061123 | negative regulation of positive chemotaxis to cAMP |
| 1. PB | GO:0032794 | GTPase activating protein binding |
| 1. PB | GO:0008283 | cell population proliferation |
| 1. PB | GO:0097648 | G protein-coupled receptor complex |
| 1. PB | GO:0016060 | metarhodopsin inactivation |
| 1. PB | GO:0019001 | guanyl nucleotide binding |
| 1. PB | GO:0045121 | membrane raft |
| 1. PB | GO:0032223 | negative regulation of synaptic transmission, cholinergic |
| 1. PB | GO:0035020 | regulation of Rac protein signal transduction |
| 1. PB | GO:0050913 | sensory perception of bitter taste |
| 1. PB | GO:0032456 | endocytic recycling |
| 1. PB | GO:0071870 | cellular response to catecholamine stimulus |
| 1. PB | GO:0060158 | phospholipase C-activating dopamine receptor signaling pathway |
| 1. PB | GO:0055037 | recycling endosome |
| 1. PB | GO:0031826 | type 2A serotonin receptor binding |
| 1. PB | GO:2000179 | positive regulation of neural precursor cell proliferation |
| 1. PB | GO:2001234 | negative regulation of apoptotic signaling pathway |
| 1. PB | GO:0035255 | ionotropic glutamate receptor binding |
| 1. PB | GO:0042711 | maternal behavior |
| 1. PB | GO:0071380 | cellular response to prostaglandin E stimulus |
| 1. PB | GO:0071880 | adenylate cyclase-activating adrenergic receptor signaling pathway |
| 1. PB | GO:0048589 | developmental growth |
| 1. PB | GO:0007191 | adenylate cyclase-activating dopamine receptor signaling pathway |
| 1. PB | GO:0007190 | activation of adenylate cyclase activity |
| 1. PB | GO:0010856 | adenylate cyclase activator activity |
| 1. PB | GO:0051343 | positive regulation of cyclic-nucleotide phosphodiesterase activity |
| 1. PB | GO:0140199 | negative regulation of adenylate cyclase-activating adrenergic receptor signaling pathway involved in heart process |
| 1. PB | GO:0098876 | vesicle-mediated transport to the plasma membrane |
| 1. PB | GO:1904706 | negative regulation of vascular associated smooth muscle cell proliferation |
| 1. PB | GO:0090543 | Flemming body |
| 1. PB | GO:0030139 | endocytic vesicle |
| 1. PB | GO:0043278 | response to morphine |
| 1. PB | GO:0030838 | positive regulation of actin filament polymerization |
| 1. PB | GO:0001973 | G protein-coupled adenosine receptor signaling pathway |
| 1. PB | GO:0008016 | regulation of heart contraction |
| 1. PB | GO:0031584 | activation of phospholipase D activity |
| 1. PB | GO:0032006 | regulation of TOR signaling |
| 1. PB | GO:0035094 | response to nicotine |
| 1. PB | GO:0007266 | Rho protein signal transduction |
| 1. PB | GO:0040032 | post-embryonic body morphogenesis |
| 1. PB | GO:0007214 | gamma-aminobutyric acid signaling pathway |
| 1. PB | GO:0033028 | myeloid cell apoptotic process |
| 1. PB | GO:0007194 | negative regulation of adenylate cyclase activity |
| 1. PB | GO:1903614 | negative regulation of protein tyrosine phosphatase activity |
| 1. PB | GO:0001726 | ruffle |
| 1. PB | GO:0046039 | GTP metabolic process |
| 1. PB | GO:0003924 | GTPase activity |
| 1. PB | GO:0001580 | detection of chemical stimulus involved in sensory perception of bitter taste |
| 1. PB | GO:0005737 | cytoplasm |
| 1. PB | GO:0051489 | regulation of filopodium assembly |
| 1. PB | GO:0016239 | positive regulation of macroautophagy |
| 1. PB | GO:0031224 | intrinsic component of membrane |
| 1. PB | GO:0005524 | ATP binding |
| 1. PB | GO:0019991 | septate junction assembly |
| 1. PB | GO:0045634 | regulation of melanocyte differentiation |
| 1. PB | GO:0031748 | D1 dopamine receptor binding |
| 1. PB | GO:0032291 | axon ensheathment in central nervous system |
| 1. PB | GO:1905099 | positive regulation of guanyl-nucleotide exchange factor activity |
| 1. PB | GO:0043938 | positive regulation of sporulation |
| 1. PB | GO:0016020 | membrane |
| 1. PB | GO:0051430 | corticotropin-releasing hormone receptor 1 binding |
| 1. PB | GO:0007200 | phospholipase C-activating G protein-coupled receptor signaling pathway |
| 1. PB | GO:0001750 | photoreceptor outer segment |
| 1. PB | GO:0070062 | extracellular exosome |
| 1. PB | GO:0042588 | zymogen granule |
| 1. PB | GO:0048066 | developmental pigmentation |
| 1. PB | GO:0060041 | retina development in camera-type eye |
| 1. PB | GO:0031526 | brush border membrane |
| 1. PB | GO:0007606 | sensory perception of chemical stimulus |
| 1. PB | GO:0007188 | adenylate cyclase-modulating G protein-coupled receptor signaling pathway |
| 1. PB | GO:0071467 | cellular response to pH |
| 1. PB | GO:0046549 | retinal cone cell development |
| 1. PB | GO:0010863 | positive regulation of phospholipase C activity |
| 1. PB | GO:1903078 | positive regulation of protein localization to plasma membrane |
| 1. PB | GO:0001501 | skeletal system development |
| 1. PB | GO:0050916 | sensory perception of sweet taste |
| 1. PB | GO:0043025 | neuronal cell body |
| 1. PB | GO:0010353 | response to trehalose |
| 1. PB | GO:1990090 | cellular response to nerve growth factor stimulus |
| 1. PB | GO:2000828 | regulation of parathyroid hormone secretion |
| 1. PB | GO:0007202 | activation of phospholipase C activity |
| 1. PB | GO:0007212 | dopamine receptor signaling pathway |
| 1. PB | GO:0031752 | D5 dopamine receptor binding |
| 1. PB | GO:0042622 | photoreceptor outer segment membrane |
| 1. PB | GO:0060348 | bone development |
| 1. PB | GO:0035810 | positive regulation of urine volume |
| 1. PB | GO:0043950 | positive regulation of cAMP-mediated signaling |
| 1. PB | GO:0055038 | recycling endosome membrane |
| 1. PB | GO:1905606 | regulation of presynapse assembly |
| 1. PB | GO:0034143 | regulation of toll-like receptor 4 signaling pathway |
| 1. PB | GO:0010975 | regulation of neuron projection development |
| 1. PB | GO:0031683 | G-protein beta/gamma-subunit complex binding |
| 1. PB | GO:0051519 | activation of bipolar cell growth |
| 1. PB | GO:0009642 | response to light intensity |
| 1. PB | GO:0060236 | regulation of mitotic spindle organization |
| 1. PB | GO:0001965 | G-protein alpha-subunit binding |
| 1. PB | GO:0032588 | trans-Golgi network membrane |
| 1. PB | GO:0090726 | cortical dynamic polarity patch |
| 1. PB | GO:0044297 | cell body |
| 1. PB | GO:0032434 | regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0099738 | cell cortex region |
| 1. PB | GO:0031698 | beta-2 adrenergic receptor binding |
| 1. PB | GO:0001917 | photoreceptor inner segment |
| 1. PB | GO:0120183 | positive regulation of focal adhesion disassembly |
| 1. PB | GO:0010913 | regulation of sterigmatocystin biosynthetic process |
| 1. PB | GO:0032154 | cleavage furrow |
| 1. PB | GO:0060857 | establishment of glial blood-brain barrier |
| 1. PB | GO:0050805 | negative regulation of synaptic transmission |
| 1. PB | GO:0071507 | pheromone response MAPK cascade |
| 1. PB | GO:0043547 | positive regulation of GTPase activity |
| 1. PB | GO:0000742 | karyogamy involved in conjugation with cellular fusion |
| 1. PB | GO:1904707 | positive regulation of vascular associated smooth muscle cell proliferation |
| 1. PB | GO:0003384 | apical constriction involved in gastrulation |
| 1. PB | GO:0001508 | action potential |
| 1. PB | GO:0007215 | glutamate receptor signaling pathway |
| 1. PB | GO:0097730 | non-motile cilium |
| 1. PB | GO:0051549 | positive regulation of keratinocyte migration |
| 1. PB | GO:0043409 | negative regulation of MAPK cascade |
| 1. PB | GO:0007601 | visual perception |
| 1. PB | GO:0006886 | intracellular protein transport |
| 1. PB | GO:0031849 | olfactory receptor binding |
| 1. PB | GO:0007193 | adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway |
| 1. PB | GO:0019003 | GDP binding |
| 1. PB | GO:0030142 | COPI-coated Golgi to ER transport vesicle |
| 1. PB | GO:0061512 | protein localization to cilium |
| 1. PB | GO:0051482 | positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway |
| 1. PB | GO:1990834 | response to odorant |
| 1. PB | GO:0007199 | G protein-coupled receptor signaling pathway coupled to cGMP nucleotide second messenger |
| 1. PB | GO:0000750 | pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| 1. PB | GO:0050908 | detection of light stimulus involved in visual perception |
| 1. PB | GO:0001889 | liver development |
| 1. PB | GO:0035815 | positive regulation of renal sodium excretion |
| 1. PB | GO:0090162 | establishment of epithelial cell polarity |
| 1. PB | GO:0010762 | regulation of fibroblast migration |
| 1. PB | GO:0051093 | negative regulation of developmental process |
| 1. PB | GO:0099562 | maintenance of postsynaptic density structure |
| 1. PB | GO:0005834 | heterotrimeric G-protein complex |
| 1. PB | GO:0016192 | vesicle-mediated transport |
| 1. PB | GO:0060998 | regulation of dendritic spine development |
| 1. PB | GO:0000287 | magnesium ion binding |
| 1. PB | GO:0000035 | acyl binding |
| 1. PB | GO:0016004 | phospholipase activator activity |
| 1. PB | GO:0030425 | dendrite |
| 1. PB | GO:0006890 | retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum |
| 1. PB | GO:0030496 | midbody |
| 1. PB | GO:0007602 | phototransduction |
| 1. PB | GO:0032930 | positive regulation of superoxide anion generation |
| 1. PB | GO:0000754 | adaptation of signaling pathway by response to pheromone involved in conjugation with cellular fusion |
| 1. PB | GO:0071257 | cellular response to electrical stimulus |
| 1. PB | GO:0007207 | phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway |
| 1. PB | GO:1903554 | G protein-coupled receptor signaling pathway involved in defense response to Gram-negative bacterium |
| 1. PB | GO:0071701 | regulation of MAPK export from nucleus |
| 1. PB | GO:0034394 | protein localization to cell surface |
| 1. PB | GO:0005930 | axoneme |
| 1. PB | GO:0048383 | mesectoderm development |
| 1. PB | GO:0007049 | cell cycle |
| 1. PB | GO:0051926 | negative regulation of calcium ion transport |
| 1. PB | GO:0031681 | G-protein beta-subunit binding |
| 1. PB | GO:0042462 | eye photoreceptor cell development |
| 1. PB | GO:0051924 | regulation of calcium ion transport |
| 1. PB | GO:0051344 | negative regulation of cyclic-nucleotide phosphodiesterase activity |
| 1. PB | GO:0000743 | nuclear migration involved in conjugation with cellular fusion |
| 1. PB | GO:0009987 | cellular process |
| 1. PB | GO:0031000 | response to caffeine |
| 1. PB | GO:0075306 | regulation of conidium formation |
| 1. PB | GO:0007213 | G protein-coupled acetylcholine receptor signaling pathway |
| 1. PB | GO:1905301 | regulation of macropinocytosis |
| 1. PB | GO:0005765 | lysosomal membrane |
| 1. PB | GO:1904778 | positive regulation of protein localization to cell cortex |
| 1. PB | GO:0003677 | DNA binding |
| 1. PB | GO:0043014 | alpha-tubulin binding |
| 1. PB | GO:0097178 | ruffle assembly |
| 1. PB | GO:0070527 | platelet aggregation |
| 1. PB | GO:2000009 | negative regulation of protein localization to cell surface |
| 1. PB | GO:0051523 | cell growth mode switching, monopolar to bipolar |
| 1. PB | GO:0006471 | protein ADP-ribosylation |
| 1. PB | GO:0031001 | response to brefeldin A |
| 1. PB | GO:0071514 | genomic imprinting |
| 1. PB | GO:0050917 | sensory perception of umami taste |
| 1. PB | GO:0043949 | regulation of cAMP-mediated signaling |
| 1. PB | GO:0031157 | regulation of aggregate size involved in sorocarp development |
| 1. PB | GO:0046628 | positive regulation of insulin receptor signaling pathway |
| 1. PB | GO:0098664 | G protein-coupled serotonin receptor signaling pathway |
| 1. PB | GO:0050714 | positive regulation of protein secretion |
| 1. PB | GO:0033864 | positive regulation of NAD(P)H oxidase activity |
| 1. PB | GO:0036010 | protein localization to endosome |
| 1. PB | GO:0045955 | negative regulation of calcium ion-dependent exocytosis |
| 1. PB | GO:0042493 | |
| 1. PB | GO:0005794 | Golgi apparatus |
| 1. PB | GO:0005525 | GTP binding |
| 1. PB | GO:0009649 | entrainment of circadian clock |
| 1. PB | GO:0031527 | filopodium membrane |
| 1. PB | GO:0032391 | photoreceptor connecting cilium |
| 1. PB | GO:0048017 | inositol lipid-mediated signaling |
| 1. PB | GO:0060271 | cilium assembly |
| 1. PB | GO:0007608 | sensory perception of smell |
| 1. PB | GO:0021884 | forebrain neuron development |
| 1. PB | GO:0016056 | rhodopsin mediated signaling pathway |
| 1. PB | GO:0030866 | cortical actin cytoskeleton organization |
| 1. PB | GO:0001664 | G protein-coupled receptor binding |
| 1. PB | GO:0035814 | negative regulation of renal sodium excretion |
| 1. PB | GO:0005813 | centrosome |
| 1. PB | GO:0097284 | hepatocyte apoptotic process |
| 1. PB | GO:0050890 | cognition |
| 1. PB | GO:0007186 | G protein-coupled receptor signaling pathway |
| 1. PB | GO:0047485 | protein N-terminus binding |
| 1. PB | GO:0046872 | metal ion binding |
| 1. PB | GO:0045202 | synapse |
| 1. PB | GO:0007603 | phototransduction, visible light |
| 1. PB | GO:0031852 | mu-type opioid receptor binding |
| 1. PB | GO:0090354 | regulation of auxin metabolic process |
| 1. PB | GO:0047391 | alkylglycerophosphoethanolamine phosphodiesterase activity |
| 1. PB | GO:0007189 | adenylate cyclase-activating G protein-coupled receptor signaling pathway |
| 1. PB | GO:0006469 | negative regulation of protein kinase activity |
| 1. PB | GO:0048488 | synaptic vesicle endocytosis |
| 1. PB | GO:0031996 | thioesterase binding |
| 1. PB | GO:0060828 | regulation of canonical Wnt signaling pathway |
| 1. PB | GO:1904322 | cellular response to forskolin |
| 1. PB | GO:1900198 | positive regulation of penicillin biosynthetic process |
| 1. PB | GO:2000171 | negative regulation of dendrite development |
| 1. PB | GO:0005938 | cell cortex |
| 1. PB | GO:0009757 | hexose mediated signaling |
| 1. PB | GO:0051301 | cell division |
| 1. PB | GO:0043326 | chemotaxis to folate |
| 1. PB | GO:1904753 | negative regulation of vascular associated smooth muscle cell migration |
| 2. P | GO:0009306 | protein secretion |
| 2. P | GO:0006998 | nuclear envelope organization |
| 2. P | GO:0070142 | synaptic vesicle budding |
| 2. P | GO:0046754 | viral exocytosis |
| 2. P | GO:0005881 | cytoplasmic microtubule |
| 2. P | GO:1902953 | positive regulation of ER to Golgi vesicle-mediated transport |
| 2. P | GO:0060292 | long-term synaptic depression |
| 2. P | GO:1901303 | negative regulation of cargo loading into COPII-coated vesicle |
| 2. P | GO:0006892 | post-Golgi vesicle-mediated transport |
| 2. P | GO:0101004 | cytolytic granule membrane |
| 2. P | GO:1905171 | positive regulation of protein localization to phagocytic vesicle |
| 2. P | GO:0005796 | Golgi lumen |
| 2. P | GO:0048705 | skeletal system morphogenesis |
| 2. P | GO:0097061 | dendritic spine organization |
| 2. P | GO:0005095 | GTPase inhibitor activity |
| 2. P | GO:0030424 | axon |
| 2. P | GO:0019002 | GMP binding |
| 2. P | GO:0031902 | late endosome membrane |
| 2. P | GO:1904748 | regulation of apoptotic process involved in development |
| 2. P | GO:0008047 | enzyme activator activity |
| 2. P | GO:1901301 | regulation of cargo loading into COPII-coated vesicle |
| 2. P | GO:0098586 | cellular response to virus |
| 2. P | GO:0032593 | insulin-responsive compartment |
| 2. P | GO:0048193 | Golgi vesicle transport |
| 2. P | GO:0012505 | endomembrane system |
| 2. P | GO:0070830 | bicellular tight junction assembly |
| 2. P | GO:0006904 | vesicle docking involved in exocytosis |
| 2. P | GO:0007021 | tubulin complex assembly |
| 2. P | GO:0034379 | very-low-density lipoprotein particle assembly |
| 2. P | GO:0045956 | positive regulation of calcium ion-dependent exocytosis |
| 2. P | GO:0005929 | cilium |
| 2. P | GO:0006888 | endoplasmic reticulum to Golgi vesicle-mediated transport |
| 2. P | GO:0008021 | synaptic vesicle |
| 2. P | GO:0030137 | COPI-coated vesicle |
| 2. P | GO:0002786 | regulation of antibacterial peptide production |
| 2. P | GO:0048259 | regulation of receptor-mediated endocytosis |
| 2. P | GO:0048487 | beta-tubulin binding |
| 2. P | GO:0034067 | protein localization to Golgi apparatus |
| 2. P | GO:0007059 | chromosome segregation |
| 2. P | GO:0140220 | pathogen-containing vacuole |
| 2. P | GO:0030540 | female genitalia development |
| 2. P | GO:0031116 | positive regulation of microtubule polymerization |
| 2. P | GO:0005774 | vacuolar membrane |
| 2. P | GO:0001778 | plasma membrane repair |
| 2. P | GO:0007107 | membrane addition at site of cytokinesis |
| 2. P | GO:1900426 | positive regulation of defense response to bacterium |
| 2. P | GO:0043622 | cortical microtubule organization |
| 2. P | GO:0005795 | Golgi stack |
| 2. P | GO:0008089 | anterograde axonal transport |
| 2. P | GO:0061909 | autophagosome-lysosome fusion |
| 2. P | GO:0005935 | cellular bud neck |
| 2. P | GO:0099575 | regulation of protein catabolic process at presynapse, modulating synaptic transmission |
| 2. P | GO:0001822 | kidney development |
| 2. P | GO:0098793 | presynapse |
| 2. P | GO:0005802 | trans-Golgi network |
| 2. P | GO:0002747 | antigen processing and presentation following phagocytosis |
| 2. P | GO:0032011 | ARF protein signal transduction |
| 2. P | GO:1902850 | microtubule cytoskeleton organization involved in mitosis |
| 2. P | GO:0072659 | protein localization to plasma membrane |
| 2. P | GO:0009792 | embryo development ending in birth or egg hatching |
| 2. P | GO:0016328 | lateral plasma membrane |
| 2. P | GO:0015031 | protein transport |
| 2. P | GO:0030030 | cell projection organization |
| 2. P | GO:0043001 | Golgi to plasma membrane protein transport |
| 2. P | GO:0030742 | GTP-dependent protein binding |
| 2. P | GO:0007006 | mitochondrial membrane organization |
| 2. P | GO:0000281 | mitotic cytokinesis |
| 2. P | GO:1990386 | mitotic cleavage furrow ingression |
| 2. P | GO:0034315 | regulation of Arp2/3 complex-mediated actin nucleation |
| 2. P | GO:0032580 | Golgi cisterna membrane |
| 2. P | GO:0007112 | male meiosis cytokinesis |
| 2. P | GO:0019882 | antigen processing and presentation |
| 2. P | GO:0031985 | Golgi cisterna |
| 2. P | GO:0070863 | positive regulation of protein exit from endoplasmic reticulum |
| 2. P | GO:0035272 | exocrine system development |
| 2. P | GO:0003925 | G protein activity |
| 2. P | GO:0005876 | spindle microtubule |
| 2. P | GO:0006906 | vesicle fusion |
| 2. P | GO:1903358 | regulation of Golgi organization |
| 2. P | GO:0030670 | phagocytic vesicle membrane |
| 2. P | GO:0005819 | spindle |
| 2. P | GO:1902824 | positive regulation of late endosome to lysosome transport |
| 2. P | GO:0090385 | phagosome-lysosome fusion |
| 2. P | GO:0005764 | lysosome |
| 2. P | GO:1900240 | negative regulation of phenotypic switching |
| 2. P | GO:0098974 | postsynaptic actin cytoskeleton organization |
| 2. P | GO:0061024 | membrane organization |
| 2. P | GO:0051457 | maintenance of protein location in nucleus |
| 2. P | GO:0005634 | nucleus |
| 2. P | GO:0031489 | myosin V binding |
| 2. P | GO:0000266 | mitochondrial fission |
| 2. P | GO:0003723 | RNA binding |
| 2. P | GO:0070971 | endoplasmic reticulum exit site |
| 2. P | GO:0009558 | embryo sac cellularization |
| 2. P | GO:0005789 | endoplasmic reticulum membrane |
| 2. P | GO:1903434 | negative regulation of constitutive secretory pathway |
| 2. P | GO:0097212 | lysosomal membrane organization |
| 2. P | GO:0006893 | Golgi to plasma membrane transport |
| 2. P | GO:0042461 | photoreceptor cell development |
| 2. P | GO:0060999 | positive regulation of dendritic spine development |
| 2. P | GO:2000156 | regulation of retrograde vesicle-mediated transport, Golgi to ER |
| 2. P | GO:0090382 | phagosome maturation |
| 2. P | GO:1990027 | S bouton |
| 2. P | GO:1903441 | protein localization to ciliary membrane |
| 2. P | GO:0048471 | perinuclear region of cytoplasm |
| 2. P | GO:0007269 | neurotransmitter secretion |
| 2. P | GO:0010009 | cytoplasmic side of endosome membrane |
| 2. P | GO:1903725 | regulation of phospholipid metabolic process |
| 2. P | GO:0090117 | endosome to lysosome transport of low-density lipoprotein particle |
| 2. P | GO:0030127 | COPII vesicle coat |
| 2. P | GO:0017157 | regulation of exocytosis |
| 2. P | GO:0098993 | anchored component of synaptic vesicle membrane |
| 2. P | GO:0055108 | Golgi to transport vesicle transport |
| 2. P | GO:0044233 | mitochondria-associated endoplasmic reticulum membrane |
| 2. P | GO:1902307 | positive regulation of sodium ion transmembrane transport |
| 2. P | GO:0031113 | regulation of microtubule polymerization |
| 2. P | GO:1902774 | late endosome to lysosome transport |
| 2. P | GO:1990583 | phospholipase D activator activity |
| 2. P | GO:0009404 | toxin metabolic process |
| 2. P | GO:0007264 | small GTPase mediated signal transduction |
| 2. P | GO:1904115 | axon cytoplasm |
| 2. P | GO:0040024 | dauer larval development |
| 2. P | GO:0032418 | lysosome localization |
| 2. P | GO:0032482 | Rab protein signal transduction |
| 2. P | GO:0015630 | microtubule cytoskeleton |
| 2. P | GO:0042073 | intraciliary transport |
| 2. P | GO:0002505 | antigen processing and presentation of polysaccharide antigen via MHC class II |
| 2. P | GO:0034260 | negative regulation of GTPase activity |
| 2. P | GO:0070861 | regulation of protein exit from endoplasmic reticulum |
| 2. P | GO:0012507 | ER to Golgi transport vesicle membrane |
| 2. P | GO:0007224 | smoothened signaling pathway |
| 2. P | GO:0031982 | vesicle |
| 2. P | GO:0010811 | positive regulation of cell-substrate adhesion |
| 2. P | GO:0000139 | Golgi membrane |
| 2. P | GO:1990927 | calcium ion regulated lysosome exocytosis |
| 2. P | GO:0003400 | regulation of COPII vesicle coating |
| 2. P | GO:0005934 | cellular bud tip |
| 2. P | GO:0045807 | positive regulation of endocytosis |
| 2. P | GO:0016050 | vesicle organization |
| 2. P | GO:0090110 | COPII-coated vesicle cargo loading |
| 2. P | GO:0051233 | spindle midzone |
| 2. P | GO:0045335 | phagocytic vesicle |
| 2. P | GO:0045880 | positive regulation of smoothened signaling pathway |
| 2. P | GO:0042267 | natural killer cell mediated cytotoxicity |
| 2. P | GO:1903292 | protein localization to Golgi membrane |
| 2. P | GO:0044257 | cellular protein catabolic process |
| 2. P | GO:0002090 | regulation of receptor internalization |
| 2. P | GO:0045196 | establishment or maintenance of neuroblast polarity |
| 3. B | GO:0099175 | regulation of postsynapse organization |
| 3. B | GO:0048701 | embryonic cranial skeleton morphogenesis |
| 3. B | GO:0045669 | positive regulation of osteoblast differentiation |
| 3. B | GO:0120162 | positive regulation of cold-induced thermogenesis |
| 3. B | GO:0010737 | protein kinase A signaling |
| 3. B | GO:1900275 | negative regulation of phospholipase C activity |
| 3. B | GO:0045672 | positive regulation of osteoclast differentiation |
| 3. B | GO:0008270 | zinc ion binding |
| 3. B | GO:0007612 | learning |
| 3. B | GO:0008356 | asymmetric cell division |
| 3. B | GO:0001958 | endochondral ossification |
| 3. B | GO:0000909 | sporocarp development involved in sexual reproduction |
| 3. B | GO:0016324 | apical plasma membrane |
| 3. B | GO:0051216 | cartilage development |
| 3. B | GO:0010765 | positive regulation of sodium ion transport |
| 3. B | GO:0007419 | ventral cord development |
| 3. B | GO:0010004 | gastrulation involving germ band extension |
| 3. B | GO:0055074 | calcium ion homeostasis |
| 3. B | GO:0007476 | imaginal disc-derived wing morphogenesis |
| 3. B | GO:0001403 | invasive growth in response to glucose limitation |
| 3. B | GO:0120169 | detection of cold stimulus involved in thermoception |
| 3. B | GO:0045776 | negative regulation of blood pressure |
| 3. B | GO:0007124 | pseudohyphal growth |
| 3. B | GO:0043209 | myelin sheath |
| 3. B | GO:0007507 | heart development |
| 3. B | GO:0007626 | locomotory behavior |
| 3. B | GO:0071107 | response to parathyroid hormone |
| 3. B | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:0042475 | odontogenesis of dentin-containing tooth |
| 3. B | GO:0035116 | embryonic hindlimb morphogenesis |
| 3. B | GO:0008284 | positive regulation of cell population proliferation |
| 3. B | GO:0097499 | protein localization to non-motile cilium |
| 3. B | GO:0043519 | regulation of myosin II filament organization |
| 3. B | GO:0002165 | instar larval or pupal development |
| 3. B | GO:0031139 | positive regulation of conjugation with cellular fusion |
| 3. B | GO:0040015 | negative regulation of multicellular organism growth |
| 3. B | GO:0016027 | inaD signaling complex |
| 3. B | GO:0048315 | conidium formation |
| 3. B | GO:0006306 | DNA methylation |
| 3. B | GO:0036267 | invasive filamentous growth |
| 3. B | GO:0034097 | response to cytokine |
| 3. B | GO:0009791 | post-embryonic development |
| 3. B | GO:0010244 | response to low fluence blue light stimulus by blue low-fluence system |
| 3. B | GO:0001894 | tissue homeostasis |
| 3. B | GO:0006112 | energy reserve metabolic process |
| 3. B | GO:0010619 | adenylate cyclase-activating glucose-activated G protein-coupled receptor signaling pathway |
| 3. B | GO:0060996 | dendritic spine development |
| 3. B | GO:0042048 | olfactory behavior |
| 3. B | GO:0010476 | gibberellin mediated signaling pathway |
| 3. B | GO:0035208 | positive regulation of hemocyte proliferation |
| 3. B | GO:0030900 | forebrain development |
| 3. B | GO:0043588 | skin development |
| 3. B | GO:0035264 | multicellular organism growth |
| 3. B | GO:0009416 | response to light stimulus |
| 3. B | GO:0010255 | glucose mediated signaling pathway |
| 3. B | GO:0045176 | apical protein localization |
| 3. B | GO:0016322 | neuron remodeling |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P30679 | Guanine nucleotide-binding protein subunit alpha-15 | 0.00e+00 | 8.44e-40 | 6.62e-77 |
| 1. PB | P62330 | ADP-ribosylation factor 6 | 4.24e-05 | 1.68e-02 | 0.003 |
| 1. PB | Q20701 | Guanine nucleotide-binding protein alpha-5 subunit | 0.00e+00 | 9.07e-34 | 3.31e-40 |
| 1. PB | Q60Z38 | ADP-ribosylation factor-like protein 6 | 2.80e-04 | 8.84e-03 | 0.035 |
| 1. PB | P10823 | Guanine nucleotide-binding protein alpha-2 subunit | 0.00e+00 | 1.07e-09 | 9.55e-59 |
| 1. PB | Q2XSV9 | Guanine nucleotide-binding protein subunit alpha-11 | 0.00e+00 | 2.68e-38 | 2.64e-82 |
| 1. PB | P20612 | Guanine nucleotide-binding protein G(t) subunit alpha-1 | 0.00e+00 | 5.28e-53 | 1.83e-82 |
| 1. PB | P25157 | Guanine nucleotide-binding protein subunit alpha homolog | 0.00e+00 | 2.70e-12 | 1.95e-63 |
| 1. PB | P38401 | Guanine nucleotide-binding protein G(i) subunit alpha-1 | 0.00e+00 | 3.05e-48 | 3.46e-82 |
| 1. PB | P84084 | ADP-ribosylation factor 5 | 7.88e-04 | 3.43e-02 | 0.030 |
| 1. PB | P22454 | Guanine nucleotide-binding protein alpha-2 subunit | 0.00e+00 | 4.82e-47 | 7.11e-62 |
| 1. PB | Q86FX7 | Guanine nucleotide-binding protein alpha-17 subunit | 0.00e+00 | 1.84e-48 | 1.35e-74 |
| 1. PB | P30669 | Guanine nucleotide-binding protein G(s) subunit alpha | 0.00e+00 | 8.72e-61 | 0.0 |
| 1. PB | Q9XZV4 | Guanine nucleotide-binding protein G(q) subunit alpha | 0.00e+00 | 1.49e-42 | 2.17e-79 |
| 1. PB | Q28300 | Guanine nucleotide-binding protein G(t) subunit alpha-1 | 0.00e+00 | 2.76e-52 | 5.56e-83 |
| 1. PB | Q19572 | Guanine nucleotide-binding protein alpha-12 subunit | 0.00e+00 | 6.85e-40 | 7.89e-74 |
| 1. PB | Q60W52 | Guanine nucleotide-binding protein alpha-3 subunit | 0.00e+00 | 1.28e-49 | 2.67e-73 |
| 1. PB | Q20907 | Guanine nucleotide-binding protein alpha-8 subunit | 0.00e+00 | 2.07e-45 | 4.99e-54 |
| 1. PB | O76584 | Guanine nucleotide-binding protein alpha-11 subunit | 0.00e+00 | 1.87e-36 | 3.25e-55 |
| 1. PB | P0CM16 | ADP-ribosylation factor | 1.86e-04 | 1.46e-03 | 0.011 |
| 1. PB | O04278 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 1.80e-41 | 7.36e-47 |
| 1. PB | P26981 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 1.81e-42 | 2.16e-43 |
| 1. PB | Q75A26 | ADP-ribosylation factor | 2.02e-04 | 3.37e-02 | 8.22e-04 |
| 1. PB | Q5RAD4 | Guanine nucleotide-binding protein G(i) subunit alpha-1 | 0.00e+00 | 1.99e-48 | 1.80e-81 |
| 1. PB | O23778 | ADP-ribosylation factor 1 | 4.02e-04 | 9.17e-04 | 0.008 |
| 1. PB | O74259 | Guanine nucleotide-binding protein subunit alpha | 0.00e+00 | 2.40e-47 | 2.83e-82 |
| 1. PB | Q4VT39 | Guanine nucleotide-binding protein alpha-13 subunit | 0.00e+00 | 5.53e-34 | 1.06e-41 |
| 1. PB | P49084 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 7.87e-37 | 2.21e-46 |
| 1. PB | P91950 | Guanine nucleotide-binding protein G(q) subunit alpha | 0.00e+00 | 1.60e-42 | 4.52e-85 |
| 1. PB | O73819 | Guanine nucleotide-binding protein subunit alpha-14 | 0.00e+00 | 1.89e-39 | 5.91e-85 |
| 1. PB | P30683 | Guanine nucleotide-binding protein G(o) subunit alpha | 0.00e+00 | 8.36e-48 | 1.82e-86 |
| 1. PB | Q7PD79 | Guanine nucleotide-binding protein G(s) subunit alpha | 0.00e+00 | 1.43e-74 | 0.0 |
| 1. PB | P87035 | Guanine nucleotide-binding protein alpha-4 subunit | 1.87e-08 | 4.47e-08 | 2.13e-28 |
| 1. PB | O15975 | Guanine nucleotide-binding protein G(q) subunit alpha | 0.00e+00 | 1.07e-37 | 1.60e-85 |
| 1. PB | Q9JID2 | Guanine nucleotide-binding protein subunit alpha-11 | 0.00e+00 | 1.37e-36 | 4.04e-83 |
| 1. PB | P16052 | Guanine nucleotide-binding protein G(s) subunit alpha | 0.00e+00 | 3.38e-118 | 0.0 |
| 1. PB | P51644 | ADP-ribosylation factor 4 | 1.58e-04 | 3.65e-02 | 0.013 |
| 1. PB | P11076 | ADP-ribosylation factor 1 | 1.56e-04 | 6.08e-03 | 0.002 |
| 1. PB | P45645 | Guanine nucleotide-binding protein subunit alpha-11 | 0.00e+00 | 6.29e-37 | 5.03e-84 |
| 1. PB | O88302 | Guanine nucleotide-binding protein subunit alpha-15 | 0.00e+00 | 3.43e-42 | 8.09e-74 |
| 1. PB | P38400 | Guanine nucleotide-binding protein G(i) subunit alpha-2 | 0.00e+00 | 3.43e-46 | 4.50e-84 |
| 1. PB | Q9N2V6 | Guanine nucleotide-binding protein alpha-16 subunit | 0.00e+00 | 7.41e-45 | 4.33e-83 |
| 1. PB | P38409 | Guanine nucleotide-binding protein subunit alpha-11 | 0.00e+00 | 4.70e-37 | 6.22e-83 |
| 1. PB | P50146 | Guanine nucleotide-binding protein G(i) subunit alpha-1 | 0.00e+00 | 3.92e-49 | 2.03e-81 |
| 1. PB | Q14344 | Guanine nucleotide-binding protein subunit alpha-13 | 0.00e+00 | 1.07e-37 | 4.91e-71 |
| 1. PB | Q60MJ0 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 2.27e-41 | 1.59e-65 |
| 1. PB | P30682 | Guanine nucleotide-binding protein G(i) subunit alpha | 0.00e+00 | 1.82e-49 | 8.76e-82 |
| 1. PB | P51822 | ADP-ribosylation factor 1 | 1.93e-04 | 6.74e-04 | 0.009 |
| 1. PB | Q86D96 | Guanine nucleotide-binding protein subunit alpha-1 | 0.00e+00 | 2.38e-11 | 6.22e-37 |
| 1. PB | P50149 | Guanine nucleotide-binding protein G(t) subunit alpha-2 | 0.00e+00 | 4.45e-56 | 1.05e-84 |
| 1. PB | P20354 | G protein alpha s subunit | 0.00e+00 | 1.42e-71 | 0.0 |
| 1. PB | P41776 | Guanine nucleotide-binding protein G(i) subunit alpha | 0.00e+00 | 3.11e-53 | 1.19e-78 |
| 1. PB | P19627 | Guanine nucleotide-binding protein G(z) subunit alpha | 0.00e+00 | 3.40e-47 | 5.35e-76 |
| 1. PB | P38404 | Guanine nucleotide-binding protein G(o) subunit alpha | 0.00e+00 | 3.07e-52 | 9.01e-88 |
| 1. PB | P21279 | Guanine nucleotide-binding protein G(q) subunit alpha | 0.00e+00 | 1.91e-38 | 4.38e-85 |
| 1. PB | Q20910 | Guanine nucleotide-binding protein alpha-9 subunit | 0.00e+00 | 2.08e-42 | 3.80e-35 |
| 1. PB | P04897 | Guanine nucleotide-binding protein G(i) subunit alpha-2 | 0.00e+00 | 3.92e-49 | 4.46e-85 |
| 1. PB | Q96361 | ADP-ribosylation factor 1 | 2.57e-05 | 8.07e-05 | 0.001 |
| 1. PB | P27601 | Guanine nucleotide-binding protein subunit alpha-13 | 0.00e+00 | 1.63e-38 | 2.90e-73 |
| 1. PB | P51875 | Guanine nucleotide-binding protein G(o) subunit alpha | 0.00e+00 | 8.36e-51 | 5.03e-86 |
| 1. PB | P40940 | ADP-ribosylation factor 3 | 2.54e-05 | 8.59e-05 | 0.002 |
| 1. PB | P84085 | ADP-ribosylation factor 5 | 2.15e-04 | 3.43e-02 | 0.030 |
| 1. PB | P38403 | Guanine nucleotide-binding protein G(i) subunit alpha-3 | 0.00e+00 | 4.94e-50 | 3.08e-80 |
| 1. PB | P87032 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 3.04e-49 | 5.65e-83 |
| 1. PB | P0CN97 | Guanine nucleotide-binding protein subunit alpha | 0.00e+00 | 1.67e-13 | 3.20e-75 |
| 1. PB | Q05337 | Guanine nucleotide-binding protein G(f) subunit alpha | 0.00e+00 | 1.24e-45 | 8.22e-81 |
| 1. PB | O70443 | Guanine nucleotide-binding protein G(z) subunit alpha | 0.00e+00 | 9.22e-47 | 5.83e-76 |
| 1. PB | P29797 | Guanine nucleotide-binding protein G(s) subunit alpha | 0.00e+00 | 3.61e-69 | 0.0 |
| 1. PB | Q9Y7B7 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 7.69e-29 | 7.56e-49 |
| 1. PB | P59216 | Guanine nucleotide-binding protein G(o) subunit alpha | 0.00e+00 | 1.27e-53 | 2.63e-86 |
| 1. PB | Q6Q7Y5 | Guanine nucleotide-binding protein subunit alpha-13 | 0.00e+00 | 1.04e-37 | 1.77e-71 |
| 1. PB | P29992 | Guanine nucleotide-binding protein subunit alpha-11 | 0.00e+00 | 1.17e-36 | 9.11e-84 |
| 1. PB | P36397 | ADP-ribosylation factor 1 | 1.21e-04 | 7.98e-05 | 0.008 |
| 1. PB | P30684 | Guanine nucleotide-binding protein G(s) subunit alpha | 0.00e+00 | 7.47e-67 | 0.0 |
| 1. PB | Q18434 | Guanine nucleotide-binding protein alpha-17 subunit | 0.00e+00 | 4.80e-49 | 6.84e-75 |
| 1. PB | Q63210 | Guanine nucleotide-binding protein subunit alpha-12 | 0.00e+00 | 1.46e-37 | 4.94e-70 |
| 1. PB | P0CM17 | ADP-ribosylation factor | 2.51e-04 | 1.46e-03 | 0.011 |
| 1. PB | O15976 | Guanine nucleotide-binding protein G(o) subunit alpha | 0.00e+00 | 3.04e-49 | 6.56e-86 |
| 1. PB | P16894 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 7.76e-46 | 8.37e-80 |
| 1. PB | Q06396 | ADP-ribosylation factor 1 | 4.13e-05 | 5.92e-04 | 0.014 |
| 1. PB | P38405 | Guanine nucleotide-binding protein G(olf) subunit alpha | 0.00e+00 | 1.15e-80 | 0.0 |
| 1. PB | Q00743 | Guanine nucleotide-binding protein subunit alpha | 0.00e+00 | 2.78e-47 | 1.28e-86 |
| 1. PB | Q7RVM2 | ADP-ribosylation factor | 1.71e-04 | 2.28e-03 | 0.006 |
| 1. PB | Q8CGK7 | Guanine nucleotide-binding protein G(olf) subunit alpha | 0.00e+00 | 1.81e-80 | 0.0 |
| 1. PB | A8MTJ3 | Guanine nucleotide-binding protein G(t) subunit alpha-3 | 0.00e+00 | 5.56e-54 | 1.88e-87 |
| 1. PB | P21278 | Guanine nucleotide-binding protein subunit alpha-11 | 0.00e+00 | 1.37e-37 | 7.16e-83 |
| 1. PB | Q61MQ8 | Guanine nucleotide-binding protein alpha-7 subunit | 0.00e+00 | 8.42e-43 | 1.95e-81 |
| 1. PB | P27584 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 2.08e-24 | 7.26e-63 |
| 1. PB | O16118 | Guanine nucleotide-binding protein G(s) subunit alpha | 0.00e+00 | 1.92e-71 | 0.0 |
| 1. PB | Q54Y14 | GTP-binding protein Sar1B | 8.06e-06 | 4.70e-05 | 0.015 |
| 1. PB | P08754 | Guanine nucleotide-binding protein G(i) subunit alpha-3 | 0.00e+00 | 2.53e-50 | 1.77e-82 |
| 1. PB | O48920 | ADP-ribosylation factor | 7.16e-05 | 2.38e-04 | 0.008 |
| 1. PB | Q8R4A8 | Guanine nucleotide-binding protein G(s) subunit alpha | 0.00e+00 | 1.07e-122 | 0.0 |
| 1. PB | Q9DC51 | Guanine nucleotide-binding protein G(i) subunit alpha-3 | 0.00e+00 | 1.43e-48 | 6.24e-81 |
| 1. PB | Q4VT31 | Guanine nucleotide-binding protein alpha-6 subunit | 0.00e+00 | 2.71e-42 | 8.06e-51 |
| 1. PB | P53359 | Guanine nucleotide-binding protein G(o) subunit alpha | 0.00e+00 | 5.48e-43 | 3.53e-78 |
| 1. PB | Q9Y7Z2 | ADP-ribosylation factor 6 | 4.85e-05 | 2.93e-05 | 0.004 |
| 1. PB | P10824 | Guanine nucleotide-binding protein G(i) subunit alpha-1 | 0.00e+00 | 3.63e-49 | 1.13e-82 |
| 1. PB | O45379 | ADP-ribosylation factor-like protein 3 | 1.09e-04 | 4.25e-03 | 0.005 |
| 1. PB | A2Y3B5 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 2.38e-39 | 1.17e-45 |
| 1. PB | P87383 | Guanine nucleotide-binding protein G(i) subunit alpha-1 | 0.00e+00 | 8.47e-50 | 6.52e-81 |
| 1. PB | P22274 | ADP-ribosylation factor | 8.50e-04 | 2.40e-04 | 0.010 |
| 1. PB | P63092 | Guanine nucleotide-binding protein G(s) subunit alpha isoforms short | 0 | 2.08e-125 | 0.0 |
| 1. PB | P08539 | Guanine nucleotide-binding protein alpha-1 subunit | 8.88e-16 | 1.13e-18 | 2.19e-45 |
| 1. PB | P51823 | ADP-ribosylation factor 2 | 1.09e-04 | 3.99e-04 | 0.015 |
| 1. PB | P27044 | Guanine nucleotide-binding protein G(i) subunit alpha-1 | 0.00e+00 | 4.49e-51 | 9.21e-81 |
| 1. PB | O00909 | ADP-ribosylation factor 1 | 1.18e-04 | 1.17e-02 | 1.61e-04 |
| 1. PB | Q40224 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 2.22e-41 | 4.22e-47 |
| 1. PB | Q4VT35 | Guanine nucleotide-binding protein alpha-2 subunit | 0.00e+00 | 1.41e-32 | 7.71e-57 |
| 1. PB | Q4VT42 | Guanine nucleotide-binding protein alpha-10 subunit | 0.00e+00 | 5.31e-40 | 2.35e-46 |
| 1. PB | P16378 | G protein alpha o subunit | 0.00e+00 | 9.21e-54 | 7.97e-83 |
| 1. PB | Q9TU29 | Guanine nucleotide-binding protein subunit alpha-15 | 0.00e+00 | 8.56e-47 | 9.66e-81 |
| 1. PB | Q61MC6 | Guanine nucleotide-binding protein alpha-8 subunit | 0.00e+00 | 1.07e-43 | 1.51e-51 |
| 1. PB | O04279 | Guanine nucleotide-binding protein alpha-2 subunit | 0.00e+00 | 4.39e-41 | 2.51e-48 |
| 1. PB | P63091 | Guanine nucleotide-binding protein G(s) subunit alpha | 0.00e+00 | 2.08e-125 | 0.0 |
| 1. PB | P08239 | Guanine nucleotide-binding protein G(o) subunit alpha | 0.00e+00 | 2.04e-53 | 9.72e-88 |
| 1. PB | O74227 | Guanine nucleotide-binding protein subunit alpha | 0.00e+00 | 1.00e-48 | 1.65e-84 |
| 1. PB | O42784 | Guanine nucleotide-binding protein subunit alpha | 0.00e+00 | 3.76e-47 | 1.01e-82 |
| 1. PB | Q613V4 | Guanine nucleotide-binding protein alpha-12 subunit | 0.00e+00 | 7.34e-40 | 8.51e-74 |
| 1. PB | P0DH91 | ADP-ribosylation factor 2-B | 1.42e-04 | 1.35e-04 | 0.008 |
| 1. PB | O95837 | Guanine nucleotide-binding protein subunit alpha-14 | 0.00e+00 | 3.50e-40 | 2.33e-81 |
| 1. PB | O13055 | Guanine nucleotide-binding protein G(i) subunit alpha-2 | 0.00e+00 | 1.38e-47 | 6.83e-80 |
| 1. PB | O14438 | Guanine nucleotide-binding protein alpha-3 subunit | 0.00e+00 | 1.88e-41 | 1.55e-77 |
| 1. PB | Q28294 | Guanine nucleotide-binding protein G(q) subunit alpha | 0.00e+00 | 1.59e-38 | 6.82e-85 |
| 1. PB | P38412 | Guanine nucleotide-binding protein G(q) subunit alpha | 0.00e+00 | 2.30e-40 | 3.16e-86 |
| 1. PB | P63096 | Guanine nucleotide-binding protein G(i) subunit alpha-1 | 0.00e+00 | 6.19e-49 | 3.39e-82 |
| 1. PB | P30676 | Guanine nucleotide-binding protein G(i) subunit alpha | 0.00e+00 | 4.98e-51 | 1.20e-81 |
| 1. PB | P34042 | Guanine nucleotide-binding protein alpha-4 subunit | 0.00e+00 | 1.64e-42 | 6.30e-68 |
| 1. PB | P28052 | Guanine nucleotide-binding protein alpha-3 subunit | 0.00e+00 | 7.19e-48 | 1.90e-73 |
| 1. PB | P38408 | Guanine nucleotide-binding protein subunit alpha-14 | 0.00e+00 | 2.73e-39 | 3.30e-81 |
| 1. PB | P38406 | Guanine nucleotide-binding protein G(olf) subunit alpha | 0.00e+00 | 2.05e-79 | 0.0 |
| 1. PB | P91924 | ADP-ribosylation factor | 2.18e-04 | 1.95e-03 | 0.013 |
| 1. PB | P30677 | Guanine nucleotide-binding protein subunit alpha-14 | 0.00e+00 | 2.91e-40 | 1.87e-78 |
| 1. PB | P11488 | Guanine nucleotide-binding protein G(t) subunit alpha-1 | 0.00e+00 | 5.75e-52 | 2.22e-82 |
| 1. PB | P29348 | Guanine nucleotide-binding protein G(t) subunit alpha-3 | 0.00e+00 | 8.49e-57 | 1.24e-90 |
| 1. PB | B2RSH2 | Guanine nucleotide-binding protein G(i) subunit alpha-1 | 0.00e+00 | 6.19e-49 | 3.39e-82 |
| 1. PB | Q55EP5 | Guanine nucleotide-binding protein-like alpha-10 subunit | 7.45e-12 | 1.92e-29 | 1.19e-25 |
| 1. PB | O48649 | ADP-ribosylation factor 1 | 2.07e-04 | 4.37e-03 | 0.006 |
| 1. PB | Q9BIG2 | Guanine nucleotide-binding protein alpha-14 subunit | 0.00e+00 | 9.99e-27 | 1.35e-36 |
| 1. PB | P04899 | Guanine nucleotide-binding protein G(i) subunit alpha-2 | 0.00e+00 | 5.48e-50 | 1.98e-84 |
| 1. PB | Q61DE0 | Guanine nucleotide-binding protein alpha-15 subunit | 0.00e+00 | 7.65e-43 | 7.94e-61 |
| 1. PB | P30678 | Guanine nucleotide-binding protein subunit alpha-15 | 0.00e+00 | 1.43e-43 | 1.00e-69 |
| 1. PB | P04696 | Guanine nucleotide-binding protein G(t) subunit alpha-2 | 0.00e+00 | 5.35e-57 | 1.14e-86 |
| 1. PB | Q60XS3 | Guanine nucleotide-binding protein alpha-16 subunit | 0.00e+00 | 1.84e-48 | 1.51e-83 |
| 1. PB | Q05424 | Guanine nucleotide-binding protein alpha-2 subunit | 0.00e+00 | 1.42e-41 | 9.51e-69 |
| 1. PB | P43444 | Guanine nucleotide-binding protein subunit alpha-11 | 0.00e+00 | 5.65e-34 | 2.06e-82 |
| 1. PB | P09471 | Guanine nucleotide-binding protein G(o) subunit alpha | 0.00e+00 | 5.87e-54 | 4.28e-86 |
| 1. PB | P19146 | ADP-ribosylation factor 2 | 2.86e-04 | 1.43e-02 | 0.006 |
| 1. PB | Q9XTB2 | Guanine nucleotide-binding protein alpha-13 subunit | 0.00e+00 | 3.75e-34 | 1.86e-44 |
| 1. PB | Q2PKF4 | Guanine nucleotide-binding protein G(q) subunit alpha | 0.00e+00 | 1.59e-38 | 6.82e-85 |
| 1. PB | P50148 | Guanine nucleotide-binding protein G(q) subunit alpha | 0.00e+00 | 1.59e-38 | 6.82e-85 |
| 1. PB | P0C7Q4 | Guanine nucleotide-binding protein G(t) subunit alpha-3 | 0.00e+00 | 1.33e-57 | 2.99e-88 |
| 1. PB | P23625 | G protein alpha q subunit | 0.00e+00 | 9.40e-37 | 1.80e-88 |
| 1. PB | P38407 | Guanine nucleotide-binding protein G(t) subunit alpha | 0.00e+00 | 1.77e-54 | 3.54e-84 |
| 1. PB | Q03113 | Guanine nucleotide-binding protein subunit alpha-12 | 0.00e+00 | 1.45e-34 | 2.93e-69 |
| 1. PB | Q4R592 | Guanine nucleotide-binding protein G(i) subunit alpha-2 | 0.00e+00 | 8.91e-50 | 3.70e-84 |
| 1. PB | P0CN96 | Guanine nucleotide-binding protein subunit alpha | 0.00e+00 | 1.67e-13 | 3.20e-75 |
| 1. PB | P34045 | Guanine nucleotide-binding protein alpha-7 subunit | 0.00e+00 | 6.84e-20 | 2.14e-59 |
| 1. PB | P51876 | Guanine nucleotide-binding protein G(i) subunit alpha | 0.00e+00 | 6.39e-50 | 1.12e-81 |
| 1. PB | P51877 | Guanine nucleotide-binding protein G(o) subunit alpha | 0.00e+00 | 1.89e-48 | 2.03e-86 |
| 1. PB | P19087 | Guanine nucleotide-binding protein G(t) subunit alpha-2 | 0.00e+00 | 3.45e-55 | 6.31e-85 |
| 1. PB | P93564 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 3.23e-41 | 9.99e-44 |
| 1. PB | P34044 | Guanine nucleotide-binding protein alpha-6 subunit | 0.00e+00 | 6.92e-44 | 6.64e-65 |
| 1. PB | Q3SZF2 | ADP-ribosylation factor 4 | 1.63e-04 | 7.76e-03 | 0.012 |
| 1. PB | P36579 | ADP-ribosylation factor 1 | 2.17e-04 | 7.61e-03 | 0.004 |
| 1. PB | P51645 | ADP-ribosylation factor 6 | 4.07e-05 | 9.35e-05 | 0.005 |
| 1. PB | P38410 | Guanine nucleotide-binding protein G(q) subunit alpha | 0.00e+00 | 1.55e-40 | 3.68e-84 |
| 1. PB | P87033 | Guanine nucleotide-binding protein alpha-2 subunit | 0.00e+00 | 5.69e-40 | 9.73e-66 |
| 1. PB | P34043 | Guanine nucleotide-binding protein alpha-5 subunit | 0.00e+00 | 1.30e-43 | 9.45e-65 |
| 1. PB | P84083 | ADP-ribosylation factor 5 | 3.39e-04 | 3.43e-02 | 0.030 |
| 1. PB | Q0DJ33 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 2.38e-39 | 1.17e-45 |
| 1. PB | Q21917 | Guanine nucleotide-binding protein alpha-7 subunit | 0.00e+00 | 4.35e-42 | 2.98e-81 |
| 1. PB | P38402 | Guanine nucleotide-binding protein G(i) subunit alpha-2 | 0.00e+00 | 6.35e-49 | 2.89e-85 |
| 1. PB | P08752 | Guanine nucleotide-binding protein G(i) subunit alpha-2 | 0.00e+00 | 2.81e-50 | 2.43e-85 |
| 1. PB | Q9XZV5 | Guanine nucleotide-binding protein G(s) subunit alpha | 0.00e+00 | 1.79e-57 | 3.96e-166 |
| 1. PB | P08753 | Guanine nucleotide-binding protein G(i) subunit alpha-3 | 0.00e+00 | 1.94e-48 | 2.69e-81 |
| 1. PB | P26990 | ADP-ribosylation factor 6 | 4.17e-05 | 1.39e-02 | 0.003 |
| 1. PB | P40946 | ADP-ribosylation factor 6 | 4.26e-05 | 5.69e-03 | 0.003 |
| 1. PB | Q9BIG4 | Guanine nucleotide-binding protein alpha-10 subunit | 0.00e+00 | 7.64e-34 | 1.34e-50 |
| 1. PB | P63094 | Guanine nucleotide-binding protein G(s) subunit alpha isoforms short | 0.00e+00 | 4.68e-123 | 0.0 |
| 1. PB | P20353 | G protein alpha i subunit | 0.00e+00 | 1.72e-52 | 7.53e-80 |
| 1. PB | Q619V5 | Guanine nucleotide-binding protein alpha-5 subunit | 0.00e+00 | 8.41e-35 | 2.79e-36 |
| 1. PB | P19086 | Guanine nucleotide-binding protein G(z) subunit alpha | 0.00e+00 | 1.80e-46 | 3.74e-77 |
| 1. PB | P18064 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 1.17e-41 | 5.80e-44 |
| 1. PB | P82471 | Guanine nucleotide-binding protein G(q) subunit alpha | 0.00e+00 | 7.84e-39 | 2.58e-85 |
| 1. PB | Q61B55 | Guanine nucleotide-binding protein alpha-4 subunit | 0.00e+00 | 2.97e-44 | 5.06e-80 |
| 1. PB | P28868 | Guanine nucleotide-binding protein subunit alpha | 2.03e-14 | 3.57e-26 | 3.45e-46 |
| 1. PB | Q4VT38 | Guanine nucleotide-binding protein alpha-14 subunit | 0.00e+00 | 1.69e-27 | 8.20e-45 |
| 1. PB | Q00580 | Guanine nucleotide-binding protein subunit alpha | 0.00e+00 | 3.23e-47 | 4.41e-83 |
| 1. PB | P27600 | Guanine nucleotide-binding protein subunit alpha-12 | 0.00e+00 | 3.01e-37 | 1.59e-69 |
| 1. PB | P49082 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 2.91e-42 | 4.43e-44 |
| 1. PB | Q54KV6 | Guanine nucleotide-binding protein alpha-3 subunit | 3.85e-09 | 1.55e-02 | 2.98e-47 |
| 1. PB | P49076 | ADP-ribosylation factor | 2.40e-04 | 3.01e-04 | 0.010 |
| 1. PB | P28051 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 2.44e-44 | 2.12e-62 |
| 1. PB | Q54R41 | Guanine nucleotide-binding protein alpha-9 subunit | 0.00e+00 | 3.04e-40 | 1.15e-57 |
| 1. PB | Q9LQC8 | ADP-ribosylation factor 2-A | 1.58e-04 | 1.35e-04 | 0.008 |
| 1. PB | P51821 | ADP-ribosylation factor 1 | 6.16e-04 | 9.61e-03 | 0.014 |
| 1. PB | Q05425 | Guanine nucleotide-binding protein alpha-1 subunit | 0.00e+00 | 3.13e-48 | 5.13e-83 |
| 1. PB | P62332 | ADP-ribosylation factor 6 | 4.09e-05 | 1.68e-02 | 0.003 |
| 1. PB | P62331 | ADP-ribosylation factor 6 | 4.27e-05 | 1.68e-02 | 0.003 |
| 1. PB | Q54VG1 | Guanine nucleotide-binding protein alpha-12 subunit | 0.00e+00 | 1.01e-38 | 7.28e-44 |
| 1. PB | P34727 | ADP-ribosylation factor | 1.16e-04 | 2.66e-03 | 0.006 |
| 1. PB | P16051 | Guanine nucleotide-binding protein alpha-2 subunit | 0.00e+00 | 9.97e-48 | 3.04e-70 |
| 1. PB | P34046 | Guanine nucleotide-binding protein alpha-8 subunit | 0.00e+00 | 9.20e-16 | 9.60e-47 |
| 1. PB | Q9HFW7 | Guanine nucleotide-binding protein alpha-3 subunit | 0.00e+00 | 7.41e-45 | 9.66e-75 |
| 1. PB | P93163 | Guanine nucleotide-binding protein alpha-2 subunit | 0.00e+00 | 1.65e-39 | 5.27e-45 |
| 1. PB | P91907 | Guanine nucleotide-binding protein alpha-15 subunit | 0.00e+00 | 5.39e-45 | 3.71e-65 |
| 1. PB | P24799 | Guanine nucleotide-binding protein G(s) subunit alpha | 0.00e+00 | 5.76e-74 | 0.0 |
| 1. PB | P18872 | Guanine nucleotide-binding protein G(o) subunit alpha | 0.00e+00 | 1.47e-52 | 1.03e-85 |
| 1. PB | P50147 | Guanine nucleotide-binding protein G(i) subunit alpha-2 | 0.00e+00 | 1.38e-49 | 2.42e-82 |
| 1. PB | P87034 | Guanine nucleotide-binding protein alpha-3 subunit | 0.00e+00 | 1.12e-41 | 1.97e-77 |
| 1. PB | P63097 | Guanine nucleotide-binding protein G(i) subunit alpha-1 | 0.00e+00 | 6.19e-49 | 3.39e-82 |
| 1. PB | Q9BIG5 | Guanine nucleotide-binding protein alpha-4 subunit | 0.00e+00 | 3.23e-43 | 3.58e-80 |
| 1. PB | Q292P9 | Guanine nucleotide-binding protein G(s) subunit alpha | 0.00e+00 | 5.52e-72 | 0.0 |
| 1. PB | P59215 | Guanine nucleotide-binding protein G(o) subunit alpha | 0.00e+00 | 1.27e-53 | 2.63e-86 |
| 1. PB | P30675 | Guanine nucleotide-binding protein subunit alpha | 0.00e+00 | 7.03e-49 | 1.22e-83 |
| 1. PB | P26991 | ADP-ribosylation factor | 8.37e-06 | 2.28e-03 | 1.79e-04 |
| 1. PB | P27045 | Guanine nucleotide-binding protein G(i) subunit alpha-3 (Fragment) | 0.00e+00 | 7.12e-43 | 6.11e-79 |
| 1. PB | P38411 | Guanine nucleotide-binding protein G(q) subunit alpha | 0.00e+00 | 2.61e-39 | 9.39e-90 |
| 1. PB | Q04665 | Guanine nucleotide-binding protein alpha-2 subunit | 0.00e+00 | 5.69e-40 | 2.92e-59 |
| 1. PB | P04896 | Guanine nucleotide-binding protein G(s) subunit alpha isoforms short | 0.00e+00 | 2.02e-121 | 0.0 |
| 1. PB | Q8T130 | Guanine nucleotide-binding protein-like alpha-11 subunit | 2.22e-15 | 5.17e-24 | 6.34e-17 |
| 1. PB | P63093 | Guanine nucleotide-binding protein G(s) subunit alpha | 0.00e+00 | 4.68e-123 | 0.0 |
| 1. PB | Q007T5 | ADP-ribosylation factor 6 | 4.20e-05 | 1.68e-02 | 0.003 |
| 1. PB | P63095 | Guanine nucleotide-binding protein G(s) subunit alpha isoforms short | 0.00e+00 | 4.68e-123 | 0.0 |
| 1. PB | Q3V3I2 | Guanine nucleotide-binding protein G(t) subunit alpha-3 | 0.00e+00 | 3.01e-58 | 1.83e-89 |
| 1. PB | Q9XZV3 | Guanine nucleotide-binding protein G(o) subunit alpha | NA | 7.37e-48 | 1.72e-83 |
| 1. PB | O13315 | Guanine nucleotide-binding protein subunit alpha | 0.00e+00 | 2.78e-47 | 1.87e-82 |
| 1. PB | A8ISN6 | ADP-ribosylation factor-like protein 3 | 4.40e-04 | 6.08e-03 | 0.034 |
| 1. PB | Q93743 | Guanine nucleotide-binding protein alpha-6 subunit | 0.00e+00 | 2.16e-44 | 5.04e-54 |
| 1. PB | P10825 | Guanine nucleotide-binding protein G(o) subunit alpha | 0.00e+00 | 3.28e-49 | 1.55e-84 |
| 1. PB | P04695 | Guanine nucleotide-binding protein G(t) subunit alpha-1 | 0.00e+00 | 2.02e-52 | 1.69e-82 |
| 2. P | Q0CUN7 | Small COPII coat GTPase sar1 | 2.00e-04 | 2.02e-02 | NA |
| 2. P | F4IZ82 | ADP-ribosylation factor-like protein 8d | 1.40e-06 | 2.29e-02 | NA |
| 2. P | Q627K4 | ADP-ribosylation factor-like protein 2 | 2.39e-06 | 3.29e-04 | NA |
| 2. P | B3LPD8 | GTP-binding protein YPT11 | 3.39e-03 | 7.75e-04 | NA |
| 2. P | Q7KQL3 | ADP-ribosylation factor 1 | 9.41e-05 | 4.72e-02 | NA |
| 2. P | P51646 | ADP-ribosylation factor-like protein 5A | 1.46e-04 | 1.26e-03 | NA |
| 2. P | Q9D0J4 | ADP-ribosylation factor-like protein 2 | 1.06e-05 | 3.03e-02 | NA |
| 2. P | B5VQB6 | GTP-binding protein YPT11 | 5.53e-03 | 4.04e-04 | NA |
| 2. P | P91580 | Putative Ras-related protein Rab-33 | 2.30e-04 | 2.23e-02 | NA |
| 2. P | Q23445 | GTP-binding protein SAR1 | 5.36e-04 | 5.59e-03 | NA |
| 2. P | Q93Y31 | ADP-ribosylation factor-like protein 8b | 2.75e-04 | 1.61e-03 | NA |
| 2. P | Q96E17 | Ras-related protein Rab-3C | 3.33e-04 | 4.58e-03 | NA |
| 2. P | Q96BM9 | ADP-ribosylation factor-like protein 8A | 2.35e-04 | 3.51e-03 | NA |
| 2. P | P0CT17 | Small COPII coat GTPase SAR1 | 2.53e-04 | 1.11e-02 | NA |
| 2. P | Q4R4S4 | ADP-ribosylation factor-like protein 8B | 3.40e-04 | 2.32e-03 | NA |
| 2. P | Q8VEH3 | ADP-ribosylation factor-like protein 8A | 2.28e-04 | 3.19e-03 | NA |
| 2. P | P61211 | ADP-ribosylation factor-like protein 1 | 1.13e-04 | 2.38e-04 | NA |
| 2. P | Q2TBW6 | ADP-ribosylation factor-like protein 3 | 7.71e-06 | 9.88e-03 | NA |
| 2. P | A1CRG9 | Small COPII coat GTPase sar1 | 7.35e-04 | 2.06e-02 | NA |
| 2. P | A6ZSH6 | GTP-binding protein YPT11 | 6.99e-04 | 3.50e-04 | NA |
| 2. P | Q19705 | ADP-ribosylation factor-like protein 2 | 2.46e-06 | 3.88e-05 | NA |
| 2. P | Q6FUZ9 | Small COPII coat GTPase SAR1 | 4.27e-04 | 4.64e-02 | NA |
| 2. P | Q2KI07 | ADP-ribosylation factor-like protein 8B | 1.26e-04 | 2.44e-03 | NA |
| 2. P | Q6P068 | ADP-ribosylation factor-like protein 5C | 3.44e-05 | 1.65e-02 | NA |
| 2. P | Q6CBB5 | GPN-loop GTPase 3 | 1.88e-02 | 4.21e-02 | NA |
| 2. P | Q01475 | Small COPII coat GTPase sar1 | 3.99e-04 | 3.11e-02 | NA |
| 2. P | Q5U1Y1 | Ras-related protein Rab-34 | 7.08e-04 | 2.63e-04 | NA |
| 2. P | Q2HA55 | Small COPII coat GTPase SAR1 | 2.07e-04 | 7.20e-03 | NA |
| 2. P | P0C951 | Small COPII coat GTPase SAR1 | 2.47e-04 | 4.45e-03 | NA |
| 2. P | P07560 | Ras-related protein SEC4 | 5.16e-04 | 3.88e-02 | NA |
| 2. P | Q54FL2 | Ras-related protein RabG2 | 6.97e-04 | 3.85e-02 | NA |
| 2. P | Q4P0I7 | Small COPII coat GTPase SAR1 | 1.79e-04 | 3.40e-02 | NA |
| 2. P | Q3T0D7 | GTP-binding protein SAR1a | 2.02e-04 | 1.56e-03 | NA |
| 2. P | P37996 | ADP-ribosylation factor-like protein 3 | 3.80e-06 | 1.75e-02 | NA |
| 2. P | Q9CQC9 | GTP-binding protein SAR1b | 1.05e-03 | 1.82e-03 | NA |
| 2. P | A6NH57 | Putative ADP-ribosylation factor-like protein 5C | 3.70e-04 | 1.08e-02 | NA |
| 2. P | Q06AU5 | Ras-related protein Rab-32 | 1.74e-03 | 4.37e-03 | NA |
| 2. P | D3Z8L7 | Ras-related protein R-Ras | 1.14e-03 | 4.28e-02 | NA |
| 2. P | Q06849 | ADP-ribosylation factor-like protein 2 | 3.36e-06 | 1.07e-04 | NA |
| 2. P | P0CR30 | Small COPII coat GTPase SAR1 | 2.28e-04 | 4.33e-03 | NA |
| 2. P | O04266 | GTP-binding protein SAR1A | 3.45e-04 | 4.33e-03 | NA |
| 2. P | Q58DI9 | ADP-ribosylation factor-like protein 11 | 6.39e-06 | 9.54e-04 | NA |
| 2. P | Q6P8C8 | ADP-ribosylation factor-like protein 8A | 1.64e-04 | 7.22e-04 | NA |
| 2. P | P0CR31 | Small COPII coat GTPase SAR1 | 2.37e-04 | 4.33e-03 | NA |
| 2. P | P97950 | Ras-related protein Rab-33A | 2.20e-06 | 7.08e-04 | NA |
| 2. P | O04834 | GTP-binding protein SAR1A | 3.86e-04 | 5.80e-03 | NA |
| 2. P | P61205 | ADP-ribosylation factor 3 | 2.92e-04 | 8.87e-05 | NA |
| 2. P | P49703 | ADP-ribosylation factor-like protein 4D | 2.30e-05 | 4.28e-02 | NA |
| 2. P | P35283 | Ras-related protein Rab-12 | 1.41e-03 | 7.27e-03 | NA |
| 2. P | Q52NJ3 | GTP-binding protein SAR1a | 2.57e-03 | 1.56e-03 | NA |
| 2. P | P0C583 | Small COPII coat GTPase sar1 | 2.01e-04 | 3.00e-02 | NA |
| 2. P | P39110 | GTP-binding protein CIN4 | 1.89e-05 | 9.24e-06 | NA |
| 2. P | Q755D7 | Small COPII coat GTPase SAR1 | 4.08e-04 | 1.04e-02 | NA |
| 2. P | P10949 | Ras-related protein Rab-3C | 3.46e-04 | 4.45e-03 | NA |
| 2. P | Q6CB54 | Small COPII coat GTPase SAR1 | 2.09e-04 | 1.04e-02 | NA |
| 2. P | Q5PYH3 | GTP-binding protein SAR1b | 7.34e-04 | 2.21e-03 | NA |
| 2. P | A1D4D1 | Small COPII coat GTPase sar1 | 2.29e-04 | 1.27e-02 | NA |
| 2. P | Q4R5P2 | ADP-ribosylation factor 1 | 4.24e-04 | 2.63e-05 | NA |
| 2. P | Q2KJ96 | ADP-ribosylation factor-like protein 5A | 1.49e-04 | 1.47e-03 | NA |
| 2. P | Q5BGB9 | Small COPII coat GTPase sar1 | 2.38e-04 | 9.61e-03 | NA |
| 2. P | Q0UKC0 | Small COPII coat GTPase SAR1 | 9.09e-05 | 1.21e-02 | NA |
| 2. P | O35963 | Ras-related protein Rab-33B | 1.53e-05 | 8.43e-03 | NA |
| 2. P | Q5M9P8 | ADP-ribosylation factor-like protein 6 | 9.34e-05 | 1.19e-02 | NA |
| 2. P | Q9BPW5 | Ras-like protein family member 11B | 4.21e-02 | 4.60e-02 | NA |
| 2. P | P84079 | ADP-ribosylation factor 1 | 2.18e-04 | 2.63e-05 | NA |
| 2. P | P52884 | GTP-binding protein SAR2 | 4.41e-04 | 1.26e-02 | NA |
| 2. P | Q2YDM1 | ADP-ribosylation factor-like protein 1 | 1.17e-04 | 1.73e-04 | NA |
| 2. P | Q5R6E7 | ADP-ribosylation factor-like protein 8B | 1.28e-04 | 8.36e-03 | NA |
| 2. P | Q59S78 | Small COPII coat GTPase SAR1 | 2.52e-04 | 1.04e-02 | NA |
| 2. P | Q9QVY3 | GTP-binding protein SAR1b | 2.02e-04 | 2.74e-03 | NA |
| 2. P | P40616 | ADP-ribosylation factor-like protein 1 | 9.49e-05 | 2.02e-04 | NA |
| 2. P | P40945 | ADP-ribosylation factor 2 | 4.74e-05 | 1.50e-03 | NA |
| 2. P | Q877B9 | Small COPII coat GTPase sar1 | 2.52e-04 | 1.62e-02 | NA |
| 2. P | Q54UF1 | ADP-ribosylation factor-like protein 2 | 6.15e-05 | 1.73e-02 | NA |
| 2. P | Q5BK71 | ADP-ribosylation factor-like protein 11 | 4.66e-06 | 9.17e-04 | NA |
| 2. P | A3LTA2 | Small COPII coat GTPase SAR1 | 5.36e-04 | 7.98e-03 | NA |
| 2. P | Q8QHI3 | ADP-ribosylation factor-like protein 3 | 2.83e-06 | 1.73e-02 | NA |
| 2. P | P38763 | Uncharacterized protein YHR022C | 1.38e-02 | 3.66e-06 | NA |
| 2. P | Q9CQW2 | ADP-ribosylation factor-like protein 8B | 1.40e-04 | 2.44e-03 | NA |
| 2. P | P49702 | ADP-ribosylation factor 5 | 4.26e-04 | 5.33e-03 | NA |
| 2. P | Q54V41 | ADP-ribosylation factor K | 2.20e-04 | 9.43e-03 | NA |
| 2. P | P51643 | ADP-ribosylation factor 1 | 2.41e-04 | 2.97e-05 | NA |
| 2. P | P61207 | ADP-ribosylation factor 3 | 2.00e-04 | 8.87e-05 | NA |
| 2. P | P36405 | ADP-ribosylation factor-like protein 3 | 4.25e-04 | 2.06e-02 | NA |
| 2. P | Q559R0 | GTP-binding protein Sar1A | 1.71e-04 | 5.34e-05 | NA |
| 2. P | Q25761 | ADP-ribosylation factor 1 | 9.72e-05 | 3.46e-02 | NA |
| 2. P | Q5R615 | Ras-related protein Rab-33B | 5.39e-06 | 3.68e-02 | NA |
| 2. P | P51156 | Ras-related protein Rab-26 | 3.18e-04 | 6.14e-03 | NA |
| 2. P | P51824 | ADP-ribosylation factor 1 | 1.53e-04 | 2.21e-02 | NA |
| 2. P | O76173 | Ras-related protein Rab-1C | 4.03e-04 | 1.10e-03 | NA |
| 2. P | Q2TA37 | ADP-ribosylation factor-like protein 2 | 1.24e-05 | 1.28e-03 | NA |
| 2. P | O95661 | GTP-binding protein Di-Ras3 | 1.86e-02 | 8.64e-04 | NA |
| 2. P | Q4WJS7 | Small COPII coat GTPase sar1 | 2.35e-04 | 1.28e-02 | NA |
| 2. P | P61210 | ADP-ribosylation factor 1 | 4.84e-04 | 2.52e-05 | NA |
| 2. P | Q5ZHV1 | Ras-related protein Rab-33B | 4.32e-06 | 2.60e-02 | NA |
| 2. P | Q64008 | Ras-related protein Rab-34 | 8.13e-05 | 2.41e-03 | NA |
| 2. P | P62824 | Ras-related protein Rab-3C | 3.32e-04 | 3.48e-03 | NA |
| 2. P | P52885 | GTP-binding protein SAR1 | 2.79e-03 | 5.97e-03 | NA |
| 2. P | Q9Y6B6 | GTP-binding protein SAR1b | 1.05e-03 | 2.56e-03 | NA |
| 2. P | P35284 | Ras-related protein Rab-12 | 1.22e-03 | 6.02e-03 | NA |
| 2. P | P61212 | ADP-ribosylation factor-like protein 1 | 1.06e-04 | 2.38e-04 | NA |
| 2. P | Q86JC8 | Ras-related protein RabH | 2.53e-03 | 2.33e-02 | NA |
| 2. P | P84081 | ADP-ribosylation factor 2 | 1.75e-04 | 2.48e-04 | NA |
| 2. P | P25160 | ADP-ribosylation factor-like protein 1 | 1.86e-04 | 1.07e-03 | NA |
| 2. P | P01114 | Transforming protein p29 | NA | 1.24e-06 | NA |
| 2. P | O42825 | GTP-binding protein RHO1 | 1.80e-04 | 5.91e-03 | NA |
| 2. P | Q80ZU0 | ADP-ribosylation factor-like protein 5A | 1.48e-04 | 4.33e-04 | NA |
| 2. P | Q9NVJ2 | ADP-ribosylation factor-like protein 8B | 1.17e-04 | 2.44e-03 | NA |
| 2. P | Q8W4C8 | ADP-ribosylation factor-like protein 8c | 1.62e-04 | 9.17e-03 | NA |
| 2. P | P61204 | ADP-ribosylation factor 3 | 1.79e-04 | 8.87e-05 | NA |
| 2. P | Q1ZXA5 | ADP-ribosylation factor-like protein DDB_G0292332 | 3.36e-04 | 3.05e-02 | NA |
| 2. P | Q6P3A9 | ADP-ribosylation factor-like protein 11 | 4.41e-06 | 3.25e-02 | NA |
| 2. P | P0CT16 | Small COPII coat GTPase SAR1 | 2.44e-04 | 1.11e-02 | NA |
| 2. P | Q66HA6 | ADP-ribosylation factor-like protein 8B | 1.17e-04 | 2.44e-03 | NA |
| 2. P | Q3T0T7 | GTP-binding protein SAR1b | 2.29e-03 | 1.82e-03 | NA |
| 2. P | P84078 | ADP-ribosylation factor 1 | 2.13e-04 | 2.63e-05 | NA |
| 2. P | P84082 | ADP-ribosylation factor 2 | 1.68e-04 | 2.48e-04 | NA |
| 2. P | Q54JJ3 | ADP-ribosylation factor H | 2.29e-04 | 2.79e-02 | NA |
| 2. P | Q52NJ4 | ADP-ribosylation factor-like protein 3 | 4.31e-04 | 2.51e-02 | NA |
| 2. P | P78976 | Small COPII coat GTPase sar1 | 2.54e-04 | 3.19e-03 | NA |
| 2. P | Q09767 | ADP-ribosylation factor-like protein alp41 | 2.00e-05 | 4.51e-04 | NA |
| 2. P | Q06543 | GPN-loop GTPase 3 | 2.42e-02 | 3.62e-02 | NA |
| 2. P | P48559 | GTP-binding protein YPT11 | 1.20e-03 | 4.04e-04 | NA |
| 2. P | Q504M8 | Ras-related protein Rab-26 | 5.85e-04 | 5.04e-04 | NA |
| 2. P | Q9CB01 | Ras-related protein RABF1 | 1.25e-03 | 2.89e-02 | NA |
| 2. P | B5FYQ0 | ADP-ribosylation factor-like protein 3 | 8.60e-06 | 3.17e-02 | NA |
| 2. P | Q54V47 | ADP-ribosylation factor J | 2.56e-04 | 7.20e-03 | NA |
| 2. P | P34212 | ADP-ribosylation factor-like protein 5 | 1.95e-04 | 4.56e-04 | NA |
| 2. P | P61209 | ADP-ribosylation factor 1 | 1.89e-04 | 2.52e-05 | NA |
| 2. P | Q5R548 | GTP-binding protein SAR1a | 2.04e-04 | 1.06e-03 | NA |
| 2. P | Q5E9I6 | ADP-ribosylation factor 3 | 1.74e-04 | 8.87e-05 | NA |
| 2. P | Q7Z444 | GTPase ERas | 4.60e-04 | 2.68e-03 | NA |
| 2. P | Q8CAM5 | Ras-related protein Rab-36 | 6.88e-05 | 1.13e-02 | NA |
| 2. P | P36404 | ADP-ribosylation factor-like protein 2 | 1.16e-05 | 2.53e-03 | NA |
| 2. P | P84080 | ADP-ribosylation factor 1 | 2.60e-04 | 2.63e-05 | NA |
| 2. P | Q6BVA7 | Small COPII coat GTPase SAR1 | 4.19e-04 | 2.74e-02 | NA |
| 2. P | Q6NZW8 | ADP-ribosylation factor-like protein 8B-A | 1.31e-04 | 2.11e-03 | NA |
| 2. P | Q54HK2 | ADP-ribosylation factor F | 1.04e-03 | 1.26e-02 | NA |
| 2. P | Q9P4C8 | Small COPII coat GTPase SAR1 | 4.36e-04 | 1.99e-03 | NA |
| 2. P | O04267 | GTP-binding protein SAR1B | 3.42e-04 | 2.98e-03 | NA |
| 2. P | Q5HZY2 | GTP-binding protein SAR1b | 8.55e-04 | 1.93e-03 | NA |
| 2. P | A5E5G3 | Small COPII coat GTPase SAR1 | 4.19e-04 | 2.35e-02 | NA |
| 2. P | Q54R04 | ADP-ribosylation factor-like protein 8 | 6.69e-05 | 5.13e-03 | NA |
| 2. P | Q06AU4 | Ras-related protein Rab-34 | 6.74e-04 | 2.39e-03 | NA |
| 2. P | Q5R5P7 | ADP-ribosylation factor 3 | 1.62e-04 | 8.87e-05 | NA |
| 2. P | P38116 | ADP-ribosylation factor-like protein 1 | 7.40e-05 | 1.40e-02 | NA |
| 2. P | Q9VHV5 | ADP-ribosylation factor-like protein 8 | 1.30e-04 | 7.06e-03 | NA |
| 2. P | Q86L51 | Ras-related protein rapB | 1.78e-03 | 2.07e-02 | NA |
| 2. P | Q02804 | ADP-ribosylation factor-like protein 3 | 2.06e-04 | 5.92e-04 | NA |
| 2. P | Q9NR31 | GTP-binding protein SAR1a | 8.15e-04 | 1.06e-03 | NA |
| 2. P | Q8MXQ2 | Ras-related protein Rab-32C | 1.91e-03 | 1.59e-02 | NA |
| 2. P | Q94650 | ADP-ribosylation factor 1 | 9.35e-05 | 4.72e-02 | NA |
| 2. P | Q9BZG1 | Ras-related protein Rab-34 | 1.70e-03 | 1.07e-03 | NA |
| 2. P | Q54RX9 | Putative ras-related protein Rab-5B | 3.94e-03 | 8.00e-06 | NA |
| 2. P | Q559X6 | Ras-related protein Rab-2B | 2.79e-04 | 9.45e-04 | NA |
| 2. P | P55042 | GTP-binding protein RAD | 2.40e-02 | 3.59e-02 | NA |
| 2. P | Q6IQ22 | Ras-related protein Rab-12 | 1.42e-03 | 1.83e-02 | NA |
| 2. P | P0C950 | Small COPII coat GTPase SAR1 | 2.22e-04 | 1.57e-03 | NA |
| 2. P | Q14088 | Ras-related protein Rab-33A | 2.61e-06 | 1.07e-02 | NA |
| 2. P | P36536 | GTP-binding protein SAR1a | 9.23e-04 | 6.41e-04 | NA |
| 2. P | Q5ZKQ8 | ADP-ribosylation factor-like protein 8A | 2.27e-04 | 4.01e-03 | NA |
| 2. P | Q8BSL7 | ADP-ribosylation factor 2 | 1.31e-04 | 2.48e-04 | NA |
| 2. P | Q9WUL7 | ADP-ribosylation factor-like protein 3 | 2.44e-04 | 2.42e-02 | NA |
| 2. P | P61206 | ADP-ribosylation factor 3 | 1.51e-04 | 8.87e-05 | NA |
| 2. P | Q9ZPX1 | ADP-ribosylation factor-like protein 2 | 6.27e-06 | 1.07e-03 | NA |
| 2. P | Q9XUC2 | Intraflagellar transport associated protein 2 | 7.07e-03 | 1.11e-03 | NA |
| 2. P | Q01474 | GTP-binding protein SAR1B | 3.50e-04 | 2.32e-03 | NA |
| 2. P | Q20758 | ADP-ribosylation factor-like protein 1 | 3.56e-05 | 1.40e-03 | NA |
| 2. P | Q10943 | ADP-ribosylation factor 1-like 2 | 4.74e-05 | 1.49e-04 | NA |
| 2. P | Q8MQT8 | GTP-binding protein Sar1 | 3.31e-03 | 2.66e-03 | NA |
| 2. P | Q8VY57 | ADP-ribosylation factor-like protein 8a | 2.87e-04 | 2.33e-04 | NA |
| 2. P | Q61LA8 | ADP-ribosylation factor 1-like 2 | 4.23e-05 | 1.32e-04 | NA |
| 2. P | P62823 | Ras-related protein Rab-3C | 3.41e-04 | 3.48e-03 | NA |
| 2. P | Q9C3Y4 | GTP-binding protein rhoA | 3.02e-04 | 3.85e-02 | NA |
| 2. P | P84077 | ADP-ribosylation factor 1 | 2.65e-04 | 2.63e-05 | NA |
| 2. P | Q5REU3 | ADP-ribosylation factor-like protein 4D | 2.23e-05 | 4.28e-02 | NA |
| 2. P | Q9Y689 | ADP-ribosylation factor-like protein 5A | 1.51e-04 | 1.46e-03 | NA |
| 3. B | P43151 | Putative guanine nucleotide-binding protein subunit alpha | 6.36e-02 | NA | 1.56e-19 |
| 3. B | P61750 | ADP-ribosylation factor 4 | 6.76e-04 | NA | 0.042 |
| 3. B | P36406 | E3 ubiquitin-protein ligase TRIM23 | 3.42e-04 | NA | 0.028 |
| 3. B | Q8BGX0 | E3 ubiquitin-protein ligase TRIM23 | 2.12e-04 | NA | 0.027 |
| 3. B | Q9SHU5 | Probable ADP-ribosylation factor At2g15310 | 1.10e-03 | NA | 7.34e-05 |
| 3. B | A8INQ0 | ADP-ribosylation factor-like protein 13B | 1.09e-02 | NA | 4.02e-04 |
| 3. B | Q5JWF2 | Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas | 0.00e+00 | NA | 0.0 |
| 3. B | Q18510 | ADP-ribosylation factor-like protein 6 | 6.39e-05 | NA | 0.035 |
| 3. B | C6KIE6 | Extra-large guanine nucleotide-binding protein 2 | 4.31e-06 | NA | 1.06e-11 |
| 3. B | P61751 | ADP-ribosylation factor 4 | 2.52e-04 | NA | 0.042 |
| 3. B | Q60397 | Guanine nucleotide-binding protein G(i) subunit alpha-3 (Fragment) | 4.09e-02 | NA | 0.022 |
| 3. B | P40994 | ADP-ribosylation factor 3 | 9.19e-05 | NA | 1.98e-05 |
| 3. B | P36407 | E3 ubiquitin-protein ligase TRIM23 | 2.63e-04 | NA | 0.026 |
| 3. B | O15743 | Protein spalten | 1.28e-08 | NA | 4.24e-08 |
| 3. B | Q8N4G2 | ADP-ribosylation factor-like protein 14 | 1.03e-05 | NA | 0.024 |
| 3. B | P52206 | Guanine nucleotide-binding protein subunit alpha-11 (Fragment) | 0.00e+00 | NA | 1.07e-45 |
| 3. B | P54111 | Guanine nucleotide-binding protein alpha-2 subunit | 1.11e-16 | NA | 2.30e-56 |
| 3. B | Q63803 | Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas | 0.00e+00 | NA | 0.0 |
| 3. B | O80462 | Extra-large guanine nucleotide-binding protein 1 | 2.90e-09 | NA | 7.32e-17 |
| 3. B | O88848 | ADP-ribosylation factor-like protein 6 | 9.80e-05 | NA | 0.039 |
| 3. B | Q6R0H7 | Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas | 0.00e+00 | NA | 0.0 |
| 3. B | Q9C516 | Extra-large guanine nucleotide-binding protein 3 | 8.67e-07 | NA | 6.29e-16 |