Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q9Y6I0
(Endogenous retrovirus group K member 6 Pro protein) with a FATCAT P-Value: 0.0 and RMSD of 3.16 angstrom. The sequence alignment identity is 89.7%.
Structural alignment shown in left. Query protein P63123 colored as red in alignment, homolog Q9Y6I0 colored as blue.
Query protein P63123 is also shown in right top, homolog Q9Y6I0 showed in right bottom. They are colored based on secondary structures.
P63123 WASQVSENRPVCKAVIQGKQLEGLVDTGADVSIIALNQWPKNWPKQKTVTGLVGIVTASEVYQSTEILHCLGPHNQESTVQPMITSIPLNLWGRDLLQQW 100 Q9Y6I0 WASQVSENRPVCKAIIQGKQFEGLVDTGADVSIIALNQWPKNWPKQKAVTGLVGIGTASEVYQSTEILHCLGPDNQESTVQPMITSIPLNLWGRDLLQQW 100 P63123 GAEITMTATLYSPMSQKIMTKMGYIPGKGLGKNEDGIKVPIEAKINHGREGTGYPF 156 Q9Y6I0 GAEITMPAPSYSPTSQKIMTKMGYIPGKGLGKNEDGIKIPVEAKINQEREGIGNPC 156
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source | GO | Description |
---|---|---|
1. PB | GO:0003676 | nucleic acid binding |
1. PB | GO:0004190 | aspartic-type endopeptidase activity |
3. B | GO:0000390 | spliceosomal complex disassembly |
3. B | GO:0016032 | viral process |
3. B | GO:0046718 | viral entry into host cell |
3. B | GO:0030430 | host cell cytoplasm |
3. B | GO:0045892 | negative regulation of transcription, DNA-templated |
3. B | GO:0044823 | retroviral integrase activity |
3. B | GO:0004523 | RNA-DNA hybrid ribonuclease activity |
3. B | GO:0008907 | integrase activity |
3. B | GO:0003887 | DNA-directed DNA polymerase activity |
3. B | GO:0046797 | viral procapsid maturation |
3. B | GO:0039657 | suppression by virus of host gene expression |
3. B | GO:0032091 | negative regulation of protein binding |
3. B | GO:0000287 | magnesium ion binding |
3. B | GO:0004483 | mRNA (nucleoside-2'-O-)-methyltransferase activity |
3. B | GO:0039651 | induction by virus of host cysteine-type endopeptidase activity involved in apoptotic process |
3. B | GO:0010600 | regulation of auxin biosynthetic process |
3. B | GO:0031012 | extracellular matrix |
3. B | GO:0008289 | lipid binding |
3. B | GO:0019072 | viral genome packaging |
3. B | GO:0003723 | RNA binding |
3. B | GO:0004170 | dUTP diphosphatase activity |
3. B | GO:0071008 | U2-type post-mRNA release spliceosomal complex |
3. B | GO:0031333 | negative regulation of protein-containing complex assembly |
3. B | GO:0005681 | spliceosomal complex |
3. B | GO:0044826 | viral genome integration into host DNA |
3. B | GO:0075713 | establishment of integrated proviral latency |
3. B | GO:0006310 | DNA recombination |
3. B | GO:0072494 | host multivesicular body |
3. B | GO:0003677 | DNA binding |
3. B | GO:0006370 | 7-methylguanosine mRNA capping |
3. B | GO:0005737 | cytoplasm |
3. B | GO:0008270 | zinc ion binding |
3. B | GO:0016020 | membrane |
3. B | GO:0044196 | host cell nucleolus |
3. B | GO:0097309 | cap1 mRNA methylation |
3. B | GO:0002134 | UTP binding |
3. B | GO:0019013 | viral nucleocapsid |
3. B | GO:0075732 | viral penetration into host nucleus |
3. B | GO:0031848 | protection from non-homologous end joining at telomere |
3. B | GO:0080009 | mRNA methylation |
3. B | GO:0003964 | RNA-directed DNA polymerase activity |
3. B | GO:0035087 | siRNA loading onto RISC involved in RNA interference |
3. B | GO:0001171 | reverse transcription |
3. B | GO:0015074 | DNA integration |
3. B | GO:0004533 | exoribonuclease H activity |
3. B | GO:0000781 | chromosome, telomeric region |
3. B | GO:0020002 | host cell plasma membrane |
3. B | GO:0042025 | host cell nucleus |
3. B | GO:0005198 | structural molecule activity |
3. B | GO:0044095 | host cell nucleoplasm |
3. B | GO:0005886 | plasma membrane |
3. B | GO:0009117 | nucleotide metabolic process |
3. B | GO:0046872 | metal ion binding |
3. B | GO:1990446 | U1 snRNP binding |
3. B | GO:0031981 | nuclear lumen |
3. B | GO:0071013 | catalytic step 2 spliceosome |
3. B | GO:0016607 | nuclear speck |
3. B | GO:0039660 | structural constituent of virion |
3. B | GO:1904876 | negative regulation of DNA ligase activity |
3. B | GO:2001033 | negative regulation of double-strand break repair via nonhomologous end joining |
3. B | GO:0055036 | virion membrane |
3. B | GO:0031214 | biomineral tissue development |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
---|---|---|---|---|---|
1. PB | P63124 | Endogenous retrovirus group K member 104 Pro protein | 3.03e-14 | 5.84e-88 | 1.26e-101 |
1. PB | P63123 | Endogenous retrovirus group K member 18 Pro protein | 0 | 3.06e-155 | 2.30e-113 |
1. PB | P63125 | Endogenous retrovirus group K member 25 Pro protein | 3.33e-16 | 5.55e-102 | 3.97e-103 |
1. PB | P63121 | Endogenous retrovirus group K member 113 Pro protein | 2.59e-13 | 4.49e-100 | 5.34e-103 |
1. PB | P63119 | Endogenous retrovirus group K member 21 Pro protein | 0.00e+00 | 4.32e-100 | 9.14e-103 |
1. PB | P63129 | Endogenous retrovirus group K member 24 Pro protein | 0.00e+00 | 1.08e-101 | 4.48e-103 |
1. PB | P63131 | Endogenous retrovirus group K member 7 Pro protein | 0.00e+00 | 1.15e-98 | 2.27e-103 |
1. PB | P10265 | Endogenous retrovirus group K member 10 Pro protein | 0.00e+00 | 6.72e-94 | 1.24e-102 |
1. PB | P63120 | Endogenous retrovirus group K member 19 Pro protein | 0.00e+00 | 6.54e-73 | 7.68e-102 |
1. PB | P63122 | Endogenous retrovirus group K member 8 Pro protein | 2.93e-14 | 6.71e-63 | 1.89e-100 |
1. PB | Q9Y6I0 | Endogenous retrovirus group K member 6 Pro protein | 0.00e+00 | 5.08e-97 | 1.29e-99 |
1. PB | P63127 | Endogenous retrovirus group K member 9 Pro protein | 0.00e+00 | 1.27e-65 | 2.77e-101 |
2. P | P15634 | Uncharacterized protein 7 | NA | 2.32e-04 | NA |
3. B | P19505 | Gag-Pol polyprotein | NA | NA | 0.001 |
3. B | Q06AK6 | Tuftelin-interacting protein 11 | 7.99e-01 | NA | 5.08e-06 |
3. B | P03364 | Gag-Pro-Pol polyprotein | NA | NA | 1.29e-26 |
3. B | O41798 | Gag-Pol polyprotein | NA | NA | 1.98e-04 |
3. B | P35963 | Gag-Pol polyprotein | NA | NA | 0.002 |
3. B | Q76634 | Gag-Pol polyprotein | NA | NA | 7.54e-07 |
3. B | Q9WC63 | Gag-Pol polyprotein | NA | NA | 0.012 |
3. B | Q9Q720 | Gag-Pol polyprotein | NA | NA | 0.002 |
3. B | Q0IIX9 | Tuftelin-interacting protein 11 | 8.88e-01 | NA | 3.13e-05 |
3. B | Q73368 | Gag-Pol polyprotein | NA | NA | 2.06e-04 |
3. B | P0C776 | Gag polyprotein | NA | NA | 0.003 |
3. B | Q74120 | Gag-Pol polyprotein | NA | NA | 2.76e-06 |
3. B | Q06152 | Uncharacterized protein YLR271W | 6.25e-01 | NA | 0.005 |
3. B | Q9SLC6 | Septin and tuftelin-interacting protein 1 homolog 2 | 9.61e-01 | NA | 0.003 |
3. B | P04589 | Gag-Pol polyprotein | NA | NA | 0.003 |
3. B | Q9QBY3 | Gag-Pol polyprotein | NA | NA | 0.003 |
3. B | Q5R5K8 | Tuftelin-interacting protein 11 | 8.58e-01 | NA | 4.44e-06 |
3. B | Q17784 | Septin and tuftelin-interacting protein 1 homolog | 9.45e-01 | NA | 0.020 |
3. B | P10271 | Gag-Pro polyprotein | NA | NA | 6.18e-14 |
3. B | P20892 | Gag-Pol polyprotein | NA | NA | 1.42e-05 |
3. B | P05961 | Gag-Pol polyprotein | NA | NA | 4.25e-05 |
3. B | Q17CQ8 | Zinc finger CCCH-type with G patch domain-containing protein | 5.55e-01 | NA | 0.007 |
3. B | P11204 | Pol polyprotein | NA | NA | 5.72e-05 |
3. B | Q5U2Z5 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 8.29e-01 | NA | 1.85e-04 |
3. B | B4HWD7 | Zinc finger CCCH-type with G patch domain-containing protein | 5.10e-01 | NA | 0.044 |
3. B | Q6DI35 | Tuftelin-interacting protein 11 | 9.57e-01 | NA | 3.96e-07 |
3. B | B4Q8A7 | Zinc finger CCCH-type with G patch domain-containing protein | 6.93e-01 | NA | 0.026 |
3. B | A1XD95 | Tuftelin-interacting protein 11 | 9.41e-01 | NA | 4.80e-06 |
3. B | P20876 | Gag-Pol polyprotein | NA | NA | 6.79e-07 |
3. B | Q9UTK6 | G-patch domain-containing protein C1486.03 | 9.51e-01 | NA | 0.005 |
3. B | O89290 | Gag-Pol polyprotein | NA | NA | 5.67e-04 |
3. B | Q9Y103 | Septin-interacting protein 1 | 8.80e-01 | NA | 6.25e-04 |
3. B | P42698 | DNA-damage-repair/toleration protein DRT111, chloroplastic | 7.14e-01 | NA | 0.029 |
3. B | P03367 | Gag-Pol polyprotein | NA | NA | 2.00e-04 |
3. B | Q9IZT2 | Gag-Pro polyprotein | NA | NA | 4.45e-14 |
3. B | Q06411 | Pre-mRNA-splicing factor SPP382 | 9.22e-01 | NA | 0.006 |
3. B | A2VE39 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 8.61e-01 | NA | 4.46e-05 |
3. B | A1XD94 | Tuftelin-interacting protein 11 | 9.21e-01 | NA | 4.44e-06 |
3. B | Q02836 | Gag-Pol polyprotein | NA | NA | 0.020 |
3. B | Q9UBB9 | Tuftelin-interacting protein 11 | 9.26e-01 | NA | 4.40e-06 |
3. B | Q803R5 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 8.21e-01 | NA | 6.64e-05 |
3. B | O89940 | Gag-Pol polyprotein | NA | NA | 0.017 |
3. B | P04587 | Gag-Pol polyprotein | NA | NA | 1.94e-04 |
3. B | A4UMC5 | Tuftelin-interacting protein 11 | 8.44e-01 | NA | 4.66e-06 |
3. B | P12451 | Gag-Pol polyprotein | NA | NA | 1.91e-05 |
3. B | Q9DBC3 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 8.55e-01 | NA | 4.08e-04 |
3. B | P04584 | Gag-Pol polyprotein | NA | NA | 2.76e-07 |
3. B | Q5U2Y6 | Tuftelin-interacting protein 11 | 9.38e-01 | NA | 4.28e-06 |
3. B | Q9VL59 | Zinc finger CCCH-type with G patch domain-containing protein | 6.24e-01 | NA | 0.026 |
3. B | P11283 | Gag-Pro-Pol polyprotein | NA | NA | 6.82e-14 |
3. B | Q9QBZ9 | Gag-Pol polyprotein | NA | NA | 7.75e-04 |
3. B | B4NYQ2 | Zinc finger CCCH-type with G patch domain-containing protein | 6.84e-01 | NA | 0.026 |
3. B | P03354 | Gag-Pol polyprotein | NA | NA | 0.003 |
3. B | Q5R981 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 5.28e-01 | NA | 3.72e-05 |
3. B | P21407 | Gag-Pro polyprotein | NA | NA | 1.56e-26 |
3. B | P07572 | Gag-Pro-Pol polyprotein | NA | NA | 5.32e-24 |
3. B | Q1A267 | Gag-Pol polyprotein | NA | NA | 0.011 |
3. B | P26315 | Proteinase p15 | NA | NA | 0.001 |
3. B | Q6GQ76 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 6.77e-01 | NA | 3.19e-04 |
3. B | P11365 | Intracisternal A-particle Gag-related polyprotein | NA | NA | 3.69e-25 |
3. B | P04588 | Gag-Pol polyprotein | NA | NA | 0.006 |
3. B | Q8N1G2 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 6.77e-01 | NA | 3.72e-05 |
3. B | D2HRF1 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 8.46e-01 | NA | 4.95e-05 |
3. B | A4UMC6 | Tuftelin-interacting protein 11 | 9.22e-01 | NA | 2.78e-06 |
3. B | P12502 | Gag-Pol polyprotein | NA | NA | 8.44e-04 |
3. B | A7SBN6 | Zinc finger CCCH-type with G patch domain-containing protein | 5.50e-01 | NA | 0.031 |
3. B | P20875 | Gag-Pol polyprotein | NA | NA | 0.001 |
3. B | P17757 | Gag-Pol polyprotein | NA | NA | 1.37e-05 |
3. B | B3MPC0 | Zinc finger CCCH-type with G patch domain-containing protein | 4.81e-01 | NA | 0.026 |
3. B | P15833 | Gag-Pol polyprotein | NA | NA | 1.15e-06 |
3. B | P51517 | Gag-Pro-Pol polyprotein | NA | NA | 7.68e-25 |
3. B | P12497 | Gag-Pol polyprotein | NA | NA | 1.61e-04 |
3. B | P0C6F2 | Gag-Pol polyprotein | NA | NA | 1.89e-04 |
3. B | P03322 | Gag polyprotein | NA | NA | 0.001 |
3. B | P03369 | Gag-Pol polyprotein | NA | NA | 0.002 |
3. B | Q5ZII9 | Tuftelin-interacting protein 11 | 9.24e-01 | NA | 5.47e-06 |
3. B | P51518 | Gag-Pro polyprotein | NA | NA | 8.74e-25 |
3. B | P05896 | Gag-Pol polyprotein | NA | NA | 7.66e-05 |
3. B | Q29NF3 | Zinc finger CCCH-type with G patch domain-containing protein | 6.36e-01 | NA | 0.043 |
3. B | P03366 | Gag-Pol polyprotein | NA | NA | 1.80e-04 |
3. B | B3N8L3 | Zinc finger CCCH-type with G patch domain-containing protein | 5.28e-01 | NA | 0.026 |
3. B | A8XYX3 | Inactive cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1B | 9.16e-01 | NA | 3.89e-04 |
3. B | Q89928 | Gag-Pol polyprotein | NA | NA | 4.59e-07 |
3. B | Q9NAA5 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 9.66e-01 | NA | 0.005 |
3. B | P18096 | Gag-Pol polyprotein | NA | NA | 2.26e-05 |
3. B | Q75002 | Gag-Pol polyprotein | NA | NA | 0.018 |
3. B | B4G7U3 | Zinc finger CCCH-type with G patch domain-containing protein | 5.28e-01 | NA | 0.043 |
3. B | Q66J74 | Tuftelin-interacting protein 11 | 7.25e-01 | NA | 2.70e-06 |
3. B | P31625 | Gag-Pro polyprotein | NA | NA | 1.30e-23 |
3. B | A1XD93 | Tuftelin-interacting protein 11 | 9.19e-01 | NA | 4.44e-06 |
3. B | P32542 | Pol polyprotein | NA | NA | 5.77e-05 |
3. B | P24107 | Gag-Pol polyprotein | NA | NA | 3.72e-07 |
3. B | O12158 | Gag-Pol polyprotein | NA | NA | 8.76e-04 |
3. B | P63128 | Endogenous retrovirus group K member 9 Pol protein | 6.60e-07 | NA | 3.02e-92 |
3. B | Q9WC54 | Gag-Pol polyprotein | NA | NA | 0.003 |
3. B | P03365 | Gag-Pro-Pol polyprotein | NA | NA | 7.88e-14 |
3. B | P03371 | Pol polyprotein | NA | NA | 5.40e-05 |
3. B | Q9QSR3 | Gag-Pol polyprotein | NA | NA | 0.001 |
3. B | Q9QBZ1 | Gag-Pol polyprotein | NA | NA | 0.002 |
3. B | Q9SHG6 | Septin and tuftelin-interacting protein 1 homolog 1 | 9.90e-01 | NA | 0.003 |
3. B | P27973 | Gag-Pol polyprotein | NA | NA | 0.004 |
3. B | O92956 | Gag-Pol polyprotein | NA | NA | 0.002 |
3. B | P05959 | Gag-Pol polyprotein | NA | NA | 8.83e-05 |
3. B | Q7PYU6 | Zinc finger CCCH-type with G patch domain-containing protein | 5.42e-01 | NA | 0.001 |
3. B | P04023 | Intracisternal A-particle Gag-related polyprotein | NA | NA | 2.31e-10 |
3. B | Q9QBZ5 | Gag-Pol polyprotein | NA | NA | 0.003 |
3. B | P04025 | Gag-Pro-Pol polyprotein | NA | NA | 5.27e-25 |
3. B | P04585 | Gag-Pol polyprotein | NA | NA | 1.87e-04 |
3. B | P31623 | Gag-Pro-Pol polyprotein | NA | NA | 7.38e-24 |
3. B | O93215 | Gag-Pol polyprotein | NA | NA | 0.002 |
3. B | Q79666 | Gag-Pol polyprotein | NA | NA | 0.032 |
3. B | P18042 | Gag-Pol polyprotein | NA | NA | 2.00e-04 |
3. B | A8XYX2 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1A | 9.27e-01 | NA | 7.23e-04 |
3. B | Q9W4N2 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 5.10e-01 | NA | 0.040 |
3. B | Q04095 | Gag-Pol polyprotein | NA | NA | 0.008 |
3. B | Q29RR5 | Tuftelin-interacting protein 11 | 8.67e-01 | NA | 4.40e-06 |
3. B | P18802 | Gag-Pol polyprotein | NA | NA | 0.001 |
3. B | P07570 | Gag-Pro polyprotein | NA | NA | 6.66e-24 |
3. B | P05962 | Gag-Pol polyprotein | NA | NA | 2.57e-05 |
3. B | O92954 | Gag polyprotein | NA | NA | 7.18e-04 |
3. B | P04024 | Gag-Pro polyprotein | NA | NA | 7.94e-25 |
3. B | P05897 | Gag-Pol polyprotein | NA | NA | 1.31e-05 |
3. B | Q9ERA6 | Tuftelin-interacting protein 11 | 9.09e-01 | NA | 4.40e-06 |
3. B | A1XD97 | Tuftelin-interacting protein 11 | 9.05e-01 | NA | 5.03e-06 |
3. B | Q8AII1 | Gag-Pol polyprotein | NA | NA | 4.13e-05 |
3. B | Q1A249 | Gag-Pol polyprotein | NA | NA | 0.050 |
3. B | P12499 | Gag-Pol polyprotein | NA | NA | 2.12e-04 |