Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P62684
(Endogenous retrovirus group K member 113 Gag polyprotein) with a FATCAT P-Value: 1.55e-15 and RMSD of 3.22 angstrom. The sequence alignment identity is 98.6%.
Structural alignment shown in left. Query protein P63126 colored as red in alignment, homolog P62684 colored as blue.
Query protein P63126 is also shown in right top, homolog P62684 showed in right bottom. They are colored based on secondary structures.
P63126 MGQTKSKIKSKYASYLSFIKILLKRGGVKVSTKNLIKLFQIIEQFCPWFPEQGTLDLKDWKRIGKELKQAGRKGNIIPLTVWNDWAIIKAALEPFQTEED 100 P62684 MGQTKSKIKSKYASYLSFIKILLKRGGVKVSTKNLIKLFQIIEQFCPWFPEQGTLDLKDWKRIGKELKQAGRKGNIIPLTVWNDWAIIKAALEPFQTEED 100 P63126 SISVSDAPGSGIIDCNEKTRKKSQKETESLHCEYVAEPVMAQSTQNVDYNQLQEVIYPETLKLEGKGPELVGPSESKPRGTSPLPAGQVPVTLQPQKQVK 200 P62684 SVSVSDAPGSCIIDCNEKTRKKSQKETESLHCEYVAEPVMAQSTQNADYNQLQEVIYPETLKLEGKGPELMGPSESKPRGTSPLPAGQVPVTLQPQKQVK 200 P63126 ENKTQPPVAYQYWPPAELQYRPPPESQYGYPGMPPAPQGRAPYPQPPTRRLNPTAPPSRQGSELHEIIDKSRKEGDTEAWQFPVTLEPMPPGEGAQEGEP 300 P62684 ENKTQPPVAYQYWPPAELQYQPPPESQYGYPGMPPAPQGRAPYPQPPTRRLNPTAPPSRQGSELHEIIDKSRKEGDTEAWQFPVTLELMPPGEGAQEGEP 300 P63126 PTVEARYKSFSIKILKDMKEGVKQYGPNSPYMRTLLDSIAHGHRLIPYDWEILAKSSLSPSQFLQFKTWWIDGVQEQVRRNRAANPPVNIDADQLLGIGQ 400 P62684 PTVEARYKSFSIKMLKDMKEGVKQYGPNSPYMRTLLDSIAHGHRLIPYDWEILAKSSLSPSQFLQFKTWWIDGVQEQVRRNRAANPPVNIDADQLLGIGQ 400 P63126 NWSTISQQALMQNEAIEQVRAICLRAWEKIQDPGSTCPSFNTVRQGSKEPYPDFVARLQDVAQKSIADEKARKVIVELMAYENANPECQSAIKPLKGKVP 500 P62684 NWSTISQQALMQNEAIEQVRAICLRAWEKIQDPGSTCPSFNTVRQGSKEPYPDFVARLQDVAQKSIADEKARKVIVELMAYENANPECQSAIKPLKGKVP 500 P63126 AGSDVISEYVKACDGIGGAMHKAMLMAQAITGVVLGGQVRTFGGKCYNCGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQCRSKFD 600 P62684 AGSDVISEYVKACDGMGGAMHKAMLMAQAITGVVLGGQVRTFGGKCYNCGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQCRSKFD 600 P63126 KNGQPLSGNEQRGQPQAPQQTGAFPIQPFVPQGFQGQQPPLSQVFQGISQLPQYNNCPPPQVAVQQ 666 P62684 KNGQPLSGNEQRGQPQAPQQTGAFPIQPFVPQGFQGQQPPLSQVFQGISQLPQYNNCPPPQAAVQQ 666
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source | GO | Description |
---|---|---|
1. PB | GO:0005737 | cytoplasm |
1. PB | GO:0016032 | viral process |
1. PB | GO:0044196 | host cell nucleolus |
1. PB | GO:0008270 | zinc ion binding |
1. PB | GO:0016020 | membrane |
1. PB | GO:0030430 | host cell cytoplasm |
1. PB | GO:0019013 | viral nucleocapsid |
1. PB | GO:0004190 | aspartic-type endopeptidase activity |
1. PB | GO:0046797 | viral procapsid maturation |
1. PB | GO:0039702 | viral budding via host ESCRT complex |
1. PB | GO:0020002 | host cell plasma membrane |
1. PB | GO:0003676 | nucleic acid binding |
1. PB | GO:0042025 | host cell nucleus |
1. PB | GO:0005198 | structural molecule activity |
1. PB | GO:0044095 | host cell nucleoplasm |
1. PB | GO:0003723 | RNA binding |
1. PB | GO:0019028 | viral capsid |
1. PB | GO:0039660 | structural constituent of virion |
1. PB | GO:0055036 | virion membrane |
1. PB | GO:0072494 | host multivesicular body |
2. P | GO:0120026 | host cell uropod |
2. P | GO:0110077 | vesicle-mediated intercellular transport |
2. P | GO:2000969 | positive regulation of AMPA receptor activity |
2. P | GO:0044185 | host cell late endosome membrane |
2. P | GO:0075521 | microtubule-dependent intracellular transport of viral material towards nucleus |
2. P | GO:0005730 | nucleolus |
2. P | GO:0044383 | host chromosome |
2. P | GO:0002437 | inflammatory response to antigenic stimulus |
2. P | GO:0019068 | virion assembly |
2. P | GO:1900452 | regulation of long-term synaptic depression |
3. B | GO:0046718 | viral entry into host cell |
3. B | GO:0005524 | ATP binding |
3. B | GO:0044823 | retroviral integrase activity |
3. B | GO:0075732 | viral penetration into host nucleus |
3. B | GO:0071037 | nuclear polyadenylation-dependent snRNA catabolic process |
3. B | GO:0004523 | RNA-DNA hybrid ribonuclease activity |
3. B | GO:0008907 | integrase activity |
3. B | GO:0003964 | RNA-directed DNA polymerase activity |
3. B | GO:0003887 | DNA-directed DNA polymerase activity |
3. B | GO:0071035 | nuclear polyadenylation-dependent rRNA catabolic process |
3. B | GO:0001171 | reverse transcription |
3. B | GO:0043657 | host cell |
3. B | GO:0039657 | suppression by virus of host gene expression |
3. B | GO:0015074 | DNA integration |
3. B | GO:0004533 | exoribonuclease H activity |
3. B | GO:0071038 | nuclear polyadenylation-dependent tRNA catabolic process |
3. B | GO:0043629 | ncRNA polyadenylation |
3. B | GO:0005886 | plasma membrane |
3. B | GO:0009117 | nucleotide metabolic process |
3. B | GO:0071031 | nuclear mRNA surveillance of mRNA 3'-end processing |
3. B | GO:0039651 | induction by virus of host cysteine-type endopeptidase activity involved in apoptotic process |
3. B | GO:0039604 | suppression by virus of host translation |
3. B | GO:0005634 | nucleus |
3. B | GO:0008289 | lipid binding |
3. B | GO:0071039 | nuclear polyadenylation-dependent CUT catabolic process |
3. B | GO:0004170 | dUTP diphosphatase activity |
3. B | GO:0031499 | TRAMP complex |
3. B | GO:0071036 | nuclear polyadenylation-dependent snoRNA catabolic process |
3. B | GO:0044826 | viral genome integration into host DNA |
3. B | GO:0075713 | establishment of integrated proviral latency |
3. B | GO:0006310 | DNA recombination |
3. B | GO:0003677 | DNA binding |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
---|---|---|---|---|---|
1. PB | P18041 | Gag polyprotein | NA | 5.69e-13 | 5.04e-10 |
1. PB | Q77372 | Gag polyprotein | NA | 8.26e-15 | 1.29e-13 |
1. PB | P16087 | Gag polyprotein | NA | 8.75e-18 | 5.36e-13 |
1. PB | P19558 | Gag polyprotein | NA | 5.05e-20 | 6.38e-16 |
1. PB | P04592 | Gag polyprotein | NA | 1.07e-13 | 3.57e-15 |
1. PB | P33458 | Gag polyprotein | NA | 2.03e-19 | 6.27e-15 |
1. PB | Q9IDV8 | Gag polyprotein | NA | 6.62e-14 | 1.13e-14 |
1. PB | P0C209 | Gag polyprotein | NA | 1.52e-13 | 6.26e-06 |
1. PB | O12157 | Gag polyprotein | NA | 1.42e-11 | 4.61e-14 |
1. PB | P25058 | Gag polyprotein | NA | 3.05e-10 | 9.67e-10 |
1. PB | Q9YNA8 | Endogenous retrovirus group K member 19 Gag polyprotein | 1.18e-12 | 6.40e-108 | 0.0 |
1. PB | P05892 | Gag polyprotein | NA | 1.02e-12 | 8.69e-16 |
1. PB | P03345 | Gag polyprotein | NA | 2.19e-15 | 2.20e-05 |
1. PB | P0C776 | Gag polyprotein | NA | 1.90e-07 | 3.25e-09 |
1. PB | Q9QBZ6 | Gag polyprotein | NA | 9.10e-13 | 7.93e-15 |
1. PB | Q82850 | Gag polyprotein | NA | 1.86e-19 | 1.93e-13 |
1. PB | P03347 | Gag polyprotein | NA | 1.56e-12 | 2.07e-15 |
1. PB | P27978 | Gag polyprotein | NA | 4.94e-11 | 9.18e-15 |
1. PB | P14076 | Gag polyprotein | NA | 1.93e-14 | 7.08e-06 |
1. PB | Q1A250 | Gag polyprotein | NA | 7.61e-12 | 7.13e-15 |
1. PB | P04022 | Gag polyprotein | NA | 4.29e-45 | 2.35e-55 |
1. PB | P51516 | Gag polyprotein | NA | 5.79e-47 | 1.55e-53 |
1. PB | P05894 | Gag polyprotein | NA | 7.18e-12 | 3.40e-09 |
1. PB | P19504 | Gag polyprotein | NA | 5.51e-15 | 1.97e-10 |
1. PB | Q9QC00 | Gag polyprotein | NA | 6.40e-13 | 1.14e-16 |
1. PB | P12495 | Gag polyprotein | NA | 2.23e-15 | 6.41e-15 |
1. PB | P15832 | Gag polyprotein | NA | 3.07e-11 | 1.72e-10 |
1. PB | Q02843 | Gag polyprotein | NA | 1.11e-10 | 8.48e-14 |
1. PB | P03352 | Gag polyprotein | NA | 2.37e-17 | 1.04e-14 |
1. PB | P12496 | Gag polyprotein | NA | 3.40e-14 | 2.82e-11 |
1. PB | P63145 | Endogenous retrovirus group K member 24 Gag polyprotein | 7.39e-14 | 7.18e-121 | 0.0 |
1. PB | P62684 | Endogenous retrovirus group K member 113 Gag polyprotein | 1.55e-15 | 1.08e-117 | 0.0 |
1. PB | P03975 | IgE-binding protein | 1.45e-03 | 2.34e-03 | 8.14e-11 |
1. PB | P17282 | Gag polyprotein | NA | 9.48e-16 | 1.32e-15 |
1. PB | P05890 | Gag polyprotein | NA | 2.70e-14 | 1.43e-16 |
1. PB | P03348 | Gag polyprotein | NA | 3.22e-12 | 6.51e-16 |
1. PB | Q9WC53 | Gag polyprotein | NA | 4.17e-12 | 9.65e-15 |
1. PB | P24106 | Gag polyprotein | NA | 8.24e-11 | 1.52e-09 |
1. PB | P18095 | Gag polyprotein | NA | 4.98e-09 | 3.09e-08 |
1. PB | P04590 | Gag polyprotein | NA | 3.64e-10 | 5.28e-11 |
1. PB | P35962 | Gag polyprotein | NA | 2.62e-14 | 4.21e-16 |
1. PB | Q74230 | Gag polyprotein | NA | 6.70e-11 | 3.79e-10 |
1. PB | P10258 | Gag polyprotein | NA | 3.73e-30 | 2.07e-55 |
1. PB | P24736 | Gag polyprotein | NA | 3.13e-12 | 1.76e-15 |
1. PB | P23425 | Gag polyprotein | NA | 2.49e-17 | 3.95e-14 |
1. PB | P20874 | Gag polyprotein | NA | 1.49e-12 | 2.05e-10 |
1. PB | Q05313 | Gag polyprotein | NA | 5.04e-17 | 2.48e-12 |
1. PB | P16900 | Gag polyprotein | NA | 2.04e-17 | 3.18e-13 |
1. PB | Q70622 | Gag polyprotein | NA | 1.11e-14 | 1.02e-15 |
1. PB | P14077 | Gag polyprotein | NA | 5.10e-15 | 1.81e-05 |
1. PB | Q79665 | Gag polyprotein | NA | 1.26e-15 | 5.79e-14 |
1. PB | P12450 | Gag polyprotein | NA | 2.46e-11 | 2.03e-07 |
1. PB | Q75001 | Gag polyprotein | NA | 3.08e-12 | 4.93e-15 |
1. PB | Q73367 | Gag polyprotein | NA | 3.20e-14 | 3.10e-15 |
1. PB | Q8AII2 | Gag polyprotein | NA | 7.71e-17 | 1.16e-16 |
1. PB | P05891 | Gag polyprotein | NA | 7.74e-13 | 1.29e-09 |
1. PB | P05887 | Gag polyprotein | NA | 1.09e-14 | 5.68e-16 |
1. PB | Q9Q721 | Gag polyprotein | NA | 2.91e-15 | 1.06e-14 |
1. PB | P69731 | Gag polyprotein | NA | 1.16e-09 | 7.43e-19 |
1. PB | P18800 | Gag polyprotein | NA | 1.12e-12 | 9.39e-15 |
1. PB | Q9HDB9 | Endogenous retrovirus group K member 5 Gag polyprotein | 3.92e-08 | 2.34e-76 | 0.0 |
1. PB | Q76633 | Gag polyprotein | NA | 1.80e-10 | 5.90e-11 |
1. PB | P12494 | Gag polyprotein | NA | 8.96e-14 | 4.47e-16 |
1. PB | Q9WC62 | Gag polyprotein | NA | 1.49e-12 | 8.23e-15 |
1. PB | P03349 | Gag polyprotein | NA | 7.52e-15 | 8.23e-16 |
1. PB | P03322 | Gag polyprotein | NA | 7.53e-09 | 8.45e-09 |
1. PB | P05888 | Gag polyprotein | NA | 6.34e-15 | 5.89e-16 |
1. PB | P19027 | Gag polyprotein | NA | 5.51e-20 | 4.34e-13 |
1. PB | P23424 | Gag polyprotein | NA | 1.28e-17 | 3.24e-14 |
1. PB | O89939 | Gag polyprotein | NA | 3.31e-12 | 1.97e-14 |
1. PB | Q9QBZ2 | Gag polyprotein | NA | 2.04e-13 | 1.03e-15 |
1. PB | P03346 | Gag polyprotein | NA | 1.43e-18 | 6.54e-06 |
1. PB | P63130 | Endogenous retrovirus group K member 7 Gag polyprotein | 2.50e-11 | 7.93e-100 | 0.0 |
1. PB | P11284 | Gag polyprotein | NA | 7.88e-29 | 1.32e-54 |
1. PB | P69730 | Gag polyprotein | NA | 1.16e-09 | 7.43e-19 |
1. PB | Q9QSR4 | Gag polyprotein | NA | 1.80e-11 | 1.16e-14 |
1. PB | Q74119 | Gag polyprotein | NA | 2.74e-10 | 1.66e-10 |
1. PB | P62685 | Endogenous retrovirus group K member 8 Gag polyprotein | 5.21e-13 | 6.91e-76 | 0.0 |
1. PB | P04593 | Gag polyprotein | NA | 2.48e-12 | 8.94e-16 |
1. PB | P04594 | Gag polyprotein | NA | 1.16e-16 | 5.36e-15 |
1. PB | P62683 | Endogenous retrovirus group K member 21 Gag polyprotein | 7.02e-13 | 8.95e-117 | 0.0 |
1. PB | P22381 | Gag polyprotein | NA | 4.69e-07 | 1.72e-12 |
1. PB | P20889 | Gag polyprotein | NA | 3.70e-16 | 2.02e-15 |
1. PB | P87889 | Endogenous retrovirus group K member 10 Gag polyprotein | 8.43e-12 | 1.82e-103 | 0.0 |
1. PB | P35955 | Gag polyprotein | NA | 9.84e-18 | 3.03e-15 |
1. PB | Q7LDI9 | Endogenous retrovirus group K member 6 Gag polyprotein | 2.76e-13 | 8.88e-115 | 0.0 |
1. PB | P12493 | Gag polyprotein | NA | 1.57e-15 | 3.38e-15 |
1. PB | P04591 | Gag polyprotein | NA | 4.68e-14 | 1.87e-15 |
1. PB | P27972 | Gag polyprotein | NA | 4.65e-15 | 1.39e-15 |
1. PB | O91079 | Gag polyprotein | NA | 1.18e-12 | 1.02e-14 |
1. PB | P31622 | Gag polyprotein | NA | 2.35e-33 | 2.45e-48 |
1. PB | Q1A268 | Gag polyprotein | NA | 7.29e-12 | 2.67e-12 |
1. PB | P63126 | Endogenous retrovirus group K member 9 Gag polyprotein | 0 | 8.03e-135 | 0.0 |
1. PB | Q09T00 | Gag polyprotein | NA | 1.14e-16 | 2.96e-06 |
1. PB | P69732 | Gag polyprotein | NA | 1.16e-09 | 7.43e-19 |
1. PB | P12498 | Gag-Pol polyprotein (Fragment) | NA | 2.69e-02 | 6.28e-16 |
1. PB | P04023 | Intracisternal A-particle Gag-related polyprotein | NA | 2.61e-17 | 2.02e-23 |
1. PB | P31634 | Gag polyprotein | NA | 1.01e-12 | 3.41e-10 |
1. PB | Q9QBY4 | Gag polyprotein | NA | 1.16e-10 | 7.39e-16 |
1. PB | P05893 | Gag polyprotein | NA | 1.30e-11 | 1.94e-08 |
1. PB | Q0R5R4 | Gag polyprotein | NA | 7.71e-17 | 1.45e-07 |
1. PB | O92954 | Gag polyprotein | NA | 1.64e-07 | 1.17e-08 |
1. PB | P05889 | Gag polyprotein (Fragment) | NA | 1.13e-09 | 6.75e-10 |
1. PB | P21411 | Gag polyprotein | NA | 1.20e-25 | 2.06e-36 |
1. PB | O93182 | Gag polyprotein | NA | 6.49e-13 | 2.44e-14 |
1. PB | P07567 | Gag polyprotein | NA | 2.16e-44 | 7.26e-54 |
1. PB | P31821 | Gag polyprotein | NA | 5.65e-17 | 2.22e-12 |
1. PB | P17756 | Gag polyprotein | NA | 5.64e-12 | 9.49e-10 |
1. PB | O89291 | Gag polyprotein | NA | 6.98e-12 | 3.65e-15 |
1. PB | P20873 | Gag polyprotein | NA | 1.53e-14 | 1.32e-15 |
1. PB | P0C1K7 | Gag polyprotein | NA | 5.44e-14 | 1.19e-12 |
2. P | P21435 | Gag polyprotein | NA | 4.62e-20 | NA |
2. P | Q8ND90 | Paraneoplastic antigen Ma1 | 5.31e-02 | 1.06e-02 | NA |
2. P | P29167 | Gag polyprotein | NA | 1.05e-19 | NA |
2. P | P0DOH4 | Glyco-Gag protein | NA | 1.73e-13 | NA |
2. P | P29168 | Gag polyprotein | NA | 2.01e-17 | NA |
2. P | Q8VHZ4 | Paraneoplastic antigen Ma1 homolog | 2.87e-02 | 1.26e-03 | NA |
2. P | P0DOH0 | Glyco-Gag protein | NA | 3.24e-15 | NA |
2. P | Q2F7I9 | Gag polyprotein | NA | 1.31e-18 | NA |
2. P | P26805 | Gag polyprotein | NA | 1.58e-18 | NA |
2. P | P03330 | Gag polyprotein | NA | 1.82e-16 | NA |
2. P | P32594 | Gag polyprotein | NA | 4.86e-07 | NA |
2. P | P27460 | Gag polyprotein | NA | 1.20e-18 | NA |
2. P | Q9TTC2 | Gag polyprotein | NA | 2.07e-18 | NA |
2. P | Q88937 | Gag polyprotein | NA | 2.02e-11 | NA |
2. P | P03340 | Gag polyprotein | NA | 3.32e-04 | NA |
2. P | Q8AWC3 | Activity-regulated cytoskeleton-associated protein | 7.77e-02 | 2.50e-05 | NA |
2. P | P0DOH6 | Glyco-Gag protein | NA | 1.07e-14 | NA |
2. P | Q87039 | Gag polyprotein | NA | 1.74e-03 | NA |
2. P | P27536 | Posterior protein | 1.99e-01 | 3.08e-03 | NA |
2. P | Q2KIT6 | Paraneoplastic antigen Ma2 homolog | 3.22e-02 | 1.98e-02 | NA |
2. P | Q27ID9 | Gag polyprotein | NA | 1.84e-18 | NA |
2. P | Q8C1C8 | Paraneoplastic antigen Ma1 homolog | 8.81e-02 | 7.86e-04 | NA |
2. P | P0DOH5 | Glyco-Gag protein | NA | 2.97e-13 | NA |
2. P | P26806 | Gag polyprotein | NA | 7.34e-19 | NA |
2. P | P03341 | Gag polyprotein | NA | 2.95e-15 | NA |
2. P | P03344 | Gag polyprotein | NA | 2.57e-07 | NA |
2. P | P26807 | Gag polyprotein | NA | 5.49e-19 | NA |
2. P | P0DOG8 | Glyco-Gag protein | NA | 3.01e-14 | NA |
2. P | Q9GMU3 | Paraneoplastic antigen Ma2 homolog | 2.88e-02 | 1.75e-03 | NA |
2. P | P03334 | Gag polyprotein | NA | 1.20e-17 | NA |
2. P | P21416 | Gag polyprotein | NA | 9.05e-18 | NA |
2. P | P0DOH2 | Glyco-Gag protein | NA | 2.57e-02 | NA |
2. P | P03332 | Gag polyprotein | NA | 3.17e-19 | NA |
2. P | P0DOH3 | Glyco-Gag protein | NA | 6.98e-12 | NA |
2. P | A6QLK5 | Paraneoplastic antigen Ma1 homolog | 4.46e-02 | 5.45e-03 | NA |
2. P | Q5R486 | Paraneoplastic antigen Ma2 homolog | 2.22e-02 | 3.90e-02 | NA |
2. P | Q2F7J2 | Gag polyprotein | NA | 4.19e-18 | NA |
2. P | P03336 | Gag polyprotein | NA | 1.05e-19 | NA |
2. P | P10262 | Gag polyprotein | NA | 7.59e-14 | NA |
2. P | Q8UN02 | Glyco-Gag protein | NA | 2.96e-14 | NA |
2. P | P11269 | Gag polyprotein | NA | 1.68e-19 | NA |
2. P | P23090 | Gag polyprotein | NA | 3.00e-18 | NA |
2. P | Q8JZW8 | Paraneoplastic antigen Ma3 homolog | 6.80e-02 | 2.53e-03 | NA |
3. B | P19505 | Gag-Pol polyprotein | NA | NA | 2.39e-10 |
3. B | P03364 | Gag-Pro-Pol polyprotein | NA | NA | 4.38e-32 |
3. B | P27980 | Gag-Pol polyprotein | NA | NA | 7.17e-15 |
3. B | O41798 | Gag-Pol polyprotein | NA | NA | 4.11e-12 |
3. B | P35963 | Gag-Pol polyprotein | NA | NA | 9.64e-16 |
3. B | Q76634 | Gag-Pol polyprotein | NA | NA | 1.29e-10 |
3. B | Q9WC63 | Gag-Pol polyprotein | NA | NA | 9.05e-15 |
3. B | Q9Q720 | Gag-Pol polyprotein | NA | NA | 1.48e-13 |
3. B | P19560 | Gag-Pol polyprotein | NA | NA | 2.29e-14 |
3. B | Q73368 | Gag-Pol polyprotein | NA | NA | 9.30e-15 |
3. B | P03343 | Gag polyprotein (Fragment) | NA | NA | 0.001 |
3. B | Q74120 | Gag-Pol polyprotein | NA | NA | 1.40e-10 |
3. B | P04589 | Gag-Pol polyprotein | NA | NA | 8.31e-15 |
3. B | Q9QBY3 | Gag-Pol polyprotein | NA | NA | 1.61e-15 |
3. B | P10271 | Gag-Pro polyprotein | NA | NA | 8.02e-55 |
3. B | P05961 | Gag-Pol polyprotein | NA | NA | 1.72e-15 |
3. B | P20892 | Gag-Pol polyprotein | NA | NA | 5.05e-15 |
3. B | Q82851 | Gag-Pol polyprotein | NA | NA | 6.47e-13 |
3. B | Q4U0X6 | Gag-Pro-Pol polyprotein | NA | NA | 2.55e-05 |
3. B | P20876 | Gag-Pol polyprotein | NA | NA | 3.15e-10 |
3. B | O89290 | Gag-Pol polyprotein | NA | NA | 7.89e-15 |
3. B | P03367 | Gag-Pol polyprotein | NA | NA | 1.63e-15 |
3. B | P03362 | Gag-Pro-Pol polyprotein | NA | NA | 2.95e-05 |
3. B | Q9IZT2 | Gag-Pro polyprotein | NA | NA | 3.03e-54 |
3. B | P23427 | Gag-Pol polyprotein | NA | NA | 4.82e-13 |
3. B | P14078 | Gag-Pro-Pol polyprotein | NA | NA | 1.36e-05 |
3. B | Q02836 | Gag-Pol polyprotein | NA | NA | 9.32e-14 |
3. B | P0DOI1 | Gag-Pro polyprotein | NA | NA | 2.76e-09 |
3. B | O76743 | ATP-dependent RNA helicase glh-4 | 6.98e-01 | NA | 0.023 |
3. B | O89940 | Gag-Pol polyprotein | NA | NA | 6.57e-14 |
3. B | P04587 | Gag-Pol polyprotein | NA | NA | 2.24e-15 |
3. B | O91080 | Gag-Pol polyprotein | NA | NA | 2.84e-14 |
3. B | P12451 | Gag-Pol polyprotein | NA | NA | 2.52e-07 |
3. B | P0C210 | Gag-Pro polyprotein | NA | NA | 6.57e-06 |
3. B | P04584 | Gag-Pol polyprotein | NA | NA | 1.20e-11 |
3. B | P11283 | Gag-Pro-Pol polyprotein | NA | NA | 1.55e-53 |
3. B | Q9QBZ9 | Gag-Pol polyprotein | NA | NA | 3.34e-16 |
3. B | P03370 | Gag-Pol polyprotein | NA | NA | 2.12e-13 |
3. B | P05895 | Gag-Pol polyprotein | NA | NA | 7.55e-15 |
3. B | P03353 | Gag-Pro polyprotein | NA | NA | 5.96e-06 |
3. B | P03354 | Gag-Pol polyprotein | NA | NA | 3.42e-08 |
3. B | P21407 | Gag-Pro polyprotein | NA | NA | 9.98e-33 |
3. B | P07572 | Gag-Pro-Pol polyprotein | NA | NA | 3.41e-46 |
3. B | Q1A267 | Gag-Pol polyprotein | NA | NA | 4.11e-11 |
3. B | Q0R5R3 | Gag-Pro polyprotein | NA | NA | 2.43e-07 |
3. B | P11365 | Intracisternal A-particle Gag-related polyprotein | NA | NA | 1.93e-30 |
3. B | P04588 | Gag-Pol polyprotein | NA | NA | 9.07e-15 |
3. B | P12502 | Gag-Pol polyprotein | NA | NA | 4.01e-11 |
3. B | P03361 | Gag-Pro-Pol polyprotein | NA | NA | 7.97e-06 |
3. B | P14074 | Gag-Pro polyprotein | NA | NA | 7.74e-06 |
3. B | P24740 | Gag-Pol polyprotein | NA | NA | 4.00e-15 |
3. B | P20875 | Gag-Pol polyprotein | NA | NA | 3.68e-15 |
3. B | Q12476 | Protein AIR2 | 6.01e-01 | NA | 0.032 |
3. B | P17757 | Gag-Pol polyprotein | NA | NA | 7.54e-10 |
3. B | P15833 | Gag-Pol polyprotein | NA | NA | 3.02e-10 |
3. B | P51517 | Gag-Pro-Pol polyprotein | NA | NA | 1.48e-45 |
3. B | P12497 | Gag-Pol polyprotein | NA | NA | 7.57e-15 |
3. B | P0C6F2 | Gag-Pol polyprotein | NA | NA | 1.79e-15 |
3. B | P03369 | Gag-Pol polyprotein | NA | NA | 2.12e-15 |
3. B | Q09SZ9 | Gag-Pro polyprotein | NA | NA | 3.18e-06 |
3. B | P31790 | Intracisternal A-particle Gag-related polyprotein | NA | NA | 2.32e-04 |
3. B | P51518 | Gag-Pro polyprotein | NA | NA | 1.70e-46 |
3. B | P35956 | Gag-Pol polyprotein | NA | NA | 7.32e-14 |
3. B | P05896 | Gag-Pol polyprotein | NA | NA | 3.32e-09 |
3. B | Q0R5R2 | Gag-Pro-Pol polyprotein | NA | NA | 1.37e-06 |
3. B | P03366 | Gag-Pol polyprotein | NA | NA | 5.38e-15 |
3. B | P03363 | Gag-Pro-Pol polyprotein | NA | NA | 8.95e-06 |
3. B | Q77373 | Gag-Pol polyprotein | NA | NA | 8.57e-14 |
3. B | Q89928 | Gag-Pol polyprotein | NA | NA | 7.74e-10 |
3. B | P18096 | Gag-Pol polyprotein | NA | NA | 1.70e-08 |
3. B | Q75002 | Gag-Pol polyprotein | NA | NA | 1.04e-14 |
3. B | P31625 | Gag-Pro polyprotein | NA | NA | 4.31e-43 |
3. B | P23426 | Gag-Pol polyprotein | NA | NA | 6.67e-13 |
3. B | O12158 | Gag-Pol polyprotein | NA | NA | 1.30e-13 |
3. B | P24107 | Gag-Pol polyprotein | NA | NA | 4.59e-10 |
3. B | P63128 | Endogenous retrovirus group K member 9 Pol protein | 2.22e-07 | NA | 0.0 |
3. B | Q9WC54 | Gag-Pol polyprotein | NA | NA | 6.76e-15 |
3. B | P25059 | Gag-Pro-Pol polyprotein | NA | NA | 1.69e-08 |
3. B | P03365 | Gag-Pro-Pol polyprotein | NA | NA | 3.64e-54 |
3. B | P22382 | Gag-Pol polyprotein | NA | NA | 3.16e-12 |
3. B | P0DOI0 | Gag-Pro polyprotein | NA | NA | 2.19e-06 |
3. B | Q9QSR3 | Gag-Pol polyprotein | NA | NA | 3.11e-14 |
3. B | Q9QBZ1 | Gag-Pol polyprotein | NA | NA | 2.94e-15 |
3. B | P27973 | Gag-Pol polyprotein | NA | NA | 1.37e-15 |
3. B | P17283 | Gag-Pol polyprotein | NA | NA | 4.79e-15 |
3. B | P05959 | Gag-Pol polyprotein | NA | NA | 2.42e-16 |
3. B | O92956 | Gag-Pol polyprotein | NA | NA | 3.25e-08 |
3. B | P40507 | Protein AIR1 | 6.85e-01 | NA | 0.031 |
3. B | Q9QBZ5 | Gag-Pol polyprotein | NA | NA | 1.71e-14 |
3. B | P04025 | Gag-Pro-Pol polyprotein | NA | NA | 1.19e-47 |
3. B | P04585 | Gag-Pol polyprotein | NA | NA | 4.60e-15 |
3. B | P31623 | Gag-Pro-Pol polyprotein | NA | NA | 7.67e-43 |
3. B | O93215 | Gag-Pol polyprotein | NA | NA | 4.21e-14 |
3. B | Q79666 | Gag-Pol polyprotein | NA | NA | 1.16e-13 |
3. B | P18042 | Gag-Pol polyprotein | NA | NA | 6.72e-11 |
3. B | P05960 | Gag-Pol polyprotein (Fragment) | NA | NA | 1.76e-15 |
3. B | Q9IDV9 | Gag-Pol polyprotein | NA | NA | 2.92e-14 |
3. B | Q04095 | Gag-Pol polyprotein | NA | NA | 7.69e-09 |
3. B | P18802 | Gag-Pol polyprotein | NA | NA | 3.57e-14 |
3. B | P07570 | Gag-Pro polyprotein | NA | NA | 3.47e-47 |
3. B | P10274 | Gag-Pro polyprotein | NA | NA | 1.97e-05 |
3. B | P05962 | Gag-Pol polyprotein | NA | NA | 1.91e-09 |
3. B | P0C211 | Gag-Pro-Pol polyprotein | NA | NA | 1.12e-05 |
3. B | P04024 | Gag-Pro polyprotein | NA | NA | 9.01e-49 |
3. B | P05897 | Gag-Pol polyprotein | NA | NA | 2.92e-09 |
3. B | Q8AII1 | Gag-Pol polyprotein | NA | NA | 1.41e-16 |
3. B | Q1A249 | Gag-Pol polyprotein | NA | NA | 9.48e-15 |
3. B | P12499 | Gag-Pol polyprotein | NA | NA | 2.16e-14 |