Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P63124
(Endogenous retrovirus group K member 104 Pro protein) with a FATCAT P-Value: 0.0 and RMSD of 1.31 angstrom. The sequence alignment identity is 97.4%.
Structural alignment shown in left. Query protein P63129 colored as red in alignment, homolog P63124 colored as blue.
Query protein P63129 is also shown in right top, homolog P63124 showed in right bottom. They are colored based on secondary structures.
P63129 WASQVSENRPVCKAIIQGKQFEGLVDTGADVSIIALNQWPKNWPKQKAVTGLVGIGTASEVYQSTEILHCLGPDNQESTVQPMITSIPLNLWGRDLLQQW 100 P63124 WASQVSENRPVCKAIIQGKQFEGLVDTEADVSIIALNQWPKNWPKQKAVTGLVGIGTASEVYQSTEILHCLGPDNQESTVQPMITSIPLNLWGQDLLQQW 100 P63129 GAEITMPAPLYSPTSQKIMTKMGYIPGKGLGKNEDGIKIPFEAKINQKREGIGYPF 156 P63124 GAEITMPAPLYSPTSQKIMTKMGYIPGKGLGKNEDGIKVPVEAKINQKREGIGYPF 156
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0003676 | nucleic acid binding |
| 1. PB | GO:0004190 | aspartic-type endopeptidase activity |
| 3. B | GO:0000390 | spliceosomal complex disassembly |
| 3. B | GO:0006370 | 7-methylguanosine mRNA capping |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0016032 | viral process |
| 3. B | GO:0046718 | viral entry into host cell |
| 3. B | GO:0008270 | zinc ion binding |
| 3. B | GO:0016020 | membrane |
| 3. B | GO:0044196 | host cell nucleolus |
| 3. B | GO:0097309 | cap1 mRNA methylation |
| 3. B | GO:0030430 | host cell cytoplasm |
| 3. B | GO:0019013 | viral nucleocapsid |
| 3. B | GO:0002134 | UTP binding |
| 3. B | GO:0044823 | retroviral integrase activity |
| 3. B | GO:0075732 | viral penetration into host nucleus |
| 3. B | GO:0031848 | protection from non-homologous end joining at telomere |
| 3. B | GO:0080009 | mRNA methylation |
| 3. B | GO:0004523 | RNA-DNA hybrid ribonuclease activity |
| 3. B | GO:0008907 | integrase activity |
| 3. B | GO:0003964 | RNA-directed DNA polymerase activity |
| 3. B | GO:0003887 | DNA-directed DNA polymerase activity |
| 3. B | GO:0046797 | viral procapsid maturation |
| 3. B | GO:0001171 | reverse transcription |
| 3. B | GO:0039657 | suppression by virus of host gene expression |
| 3. B | GO:0015074 | DNA integration |
| 3. B | GO:0004533 | exoribonuclease H activity |
| 3. B | GO:0000781 | chromosome, telomeric region |
| 3. B | GO:0020002 | host cell plasma membrane |
| 3. B | GO:0042025 | host cell nucleus |
| 3. B | GO:0005198 | structural molecule activity |
| 3. B | GO:0032091 | negative regulation of protein binding |
| 3. B | GO:0044095 | host cell nucleoplasm |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:0000287 | magnesium ion binding |
| 3. B | GO:0009117 | nucleotide metabolic process |
| 3. B | GO:0004483 | mRNA (nucleoside-2'-O-)-methyltransferase activity |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0039651 | induction by virus of host cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0010600 | regulation of auxin biosynthetic process |
| 3. B | GO:0031012 | extracellular matrix |
| 3. B | GO:0008289 | lipid binding |
| 3. B | GO:1990446 | U1 snRNP binding |
| 3. B | GO:0031981 | nuclear lumen |
| 3. B | GO:0019072 | viral genome packaging |
| 3. B | GO:0071013 | catalytic step 2 spliceosome |
| 3. B | GO:0016607 | nuclear speck |
| 3. B | GO:0003723 | RNA binding |
| 3. B | GO:0039660 | structural constituent of virion |
| 3. B | GO:0004170 | dUTP diphosphatase activity |
| 3. B | GO:0031214 | biomineral tissue development |
| 3. B | GO:0071008 | U2-type post-mRNA release spliceosomal complex |
| 3. B | GO:1904876 | negative regulation of DNA ligase activity |
| 3. B | GO:0031333 | negative regulation of protein-containing complex assembly |
| 3. B | GO:2001033 | negative regulation of double-strand break repair via nonhomologous end joining |
| 3. B | GO:0005681 | spliceosomal complex |
| 3. B | GO:0044826 | viral genome integration into host DNA |
| 3. B | GO:0055036 | virion membrane |
| 3. B | GO:0075713 | establishment of integrated proviral latency |
| 3. B | GO:0006310 | DNA recombination |
| 3. B | GO:0072494 | host multivesicular body |
| 3. B | GO:0003677 | DNA binding |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P63124 | Endogenous retrovirus group K member 104 Pro protein | 0.00e+00 | 1.16e-91 | 7.99e-110 |
| 1. PB | P63123 | Endogenous retrovirus group K member 18 Pro protein | 0.00e+00 | 1.29e-91 | 4.48e-103 |
| 1. PB | P63125 | Endogenous retrovirus group K member 25 Pro protein | 0.00e+00 | 1.07e-125 | 1.09e-111 |
| 1. PB | P63121 | Endogenous retrovirus group K member 113 Pro protein | 0.00e+00 | 6.61e-114 | 9.12e-110 |
| 1. PB | P63119 | Endogenous retrovirus group K member 21 Pro protein | 0.00e+00 | 2.56e-123 | 5.20e-111 |
| 1. PB | P63129 | Endogenous retrovirus group K member 24 Pro protein | 0 | 5.38e-140 | 5.47e-113 |
| 1. PB | P63131 | Endogenous retrovirus group K member 7 Pro protein | 0.00e+00 | 6.97e-117 | 3.43e-111 |
| 1. PB | P10265 | Endogenous retrovirus group K member 10 Pro protein | 0.00e+00 | 2.55e-111 | 2.29e-110 |
| 1. PB | P63120 | Endogenous retrovirus group K member 19 Pro protein | 0.00e+00 | 1.13e-84 | 1.46e-110 |
| 1. PB | P63122 | Endogenous retrovirus group K member 8 Pro protein | 0.00e+00 | 9.15e-77 | 2.64e-110 |
| 1. PB | Q9Y6I0 | Endogenous retrovirus group K member 6 Pro protein | 8.88e-16 | 5.97e-111 | 8.76e-108 |
| 1. PB | P63127 | Endogenous retrovirus group K member 9 Pro protein | 1.11e-16 | 2.72e-78 | 3.91e-111 |
| 2. P | P15634 | Uncharacterized protein 7 | NA | 1.41e-05 | NA |
| 3. B | P19505 | Gag-Pol polyprotein | NA | NA | 0.002 |
| 3. B | Q06AK6 | Tuftelin-interacting protein 11 | 7.55e-01 | NA | 8.92e-05 |
| 3. B | P03364 | Gag-Pro-Pol polyprotein | NA | NA | 7.56e-29 |
| 3. B | O41798 | Gag-Pol polyprotein | NA | NA | 1.30e-04 |
| 3. B | P35963 | Gag-Pol polyprotein | NA | NA | 0.014 |
| 3. B | Q76634 | Gag-Pol polyprotein | NA | NA | 3.82e-06 |
| 3. B | Q9WC63 | Gag-Pol polyprotein | NA | NA | 0.007 |
| 3. B | Q9Q720 | Gag-Pol polyprotein | NA | NA | 0.002 |
| 3. B | Q0IIX9 | Tuftelin-interacting protein 11 | 8.90e-01 | NA | 6.85e-04 |
| 3. B | P0C776 | Gag polyprotein | NA | NA | 9.87e-05 |
| 3. B | Q73368 | Gag-Pol polyprotein | NA | NA | 0.004 |
| 3. B | Q74120 | Gag-Pol polyprotein | NA | NA | 8.43e-06 |
| 3. B | Q06152 | Uncharacterized protein YLR271W | 2.85e-01 | NA | 0.002 |
| 3. B | Q9SLC6 | Septin and tuftelin-interacting protein 1 homolog 2 | 8.44e-01 | NA | 0.004 |
| 3. B | P04589 | Gag-Pol polyprotein | NA | NA | 0.004 |
| 3. B | Q9QBY3 | Gag-Pol polyprotein | NA | NA | 0.002 |
| 3. B | Q5R5K8 | Tuftelin-interacting protein 11 | 8.70e-01 | NA | 9.18e-05 |
| 3. B | P10271 | Gag-Pro polyprotein | NA | NA | 4.74e-16 |
| 3. B | P05961 | Gag-Pol polyprotein | NA | NA | 2.46e-04 |
| 3. B | P20892 | Gag-Pol polyprotein | NA | NA | 2.84e-04 |
| 3. B | Q17CQ8 | Zinc finger CCCH-type with G patch domain-containing protein | 3.67e-01 | NA | 0.043 |
| 3. B | P11204 | Pol polyprotein | NA | NA | 4.26e-05 |
| 3. B | Q5U2Z5 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 8.61e-01 | NA | 0.003 |
| 3. B | Q6DI35 | Tuftelin-interacting protein 11 | 9.02e-01 | NA | 5.48e-06 |
| 3. B | A1XD95 | Tuftelin-interacting protein 11 | 9.46e-01 | NA | 8.51e-05 |
| 3. B | P20876 | Gag-Pol polyprotein | NA | NA | 1.60e-06 |
| 3. B | Q9UTK6 | G-patch domain-containing protein C1486.03 | 7.01e-01 | NA | 0.003 |
| 3. B | O89290 | Gag-Pol polyprotein | NA | NA | 0.011 |
| 3. B | Q9Y103 | Septin-interacting protein 1 | 8.17e-01 | NA | 0.002 |
| 3. B | P42698 | DNA-damage-repair/toleration protein DRT111, chloroplastic | 3.80e-01 | NA | 0.004 |
| 3. B | P03367 | Gag-Pol polyprotein | NA | NA | 0.001 |
| 3. B | Q9IZT2 | Gag-Pro polyprotein | NA | NA | 3.72e-16 |
| 3. B | Q06411 | Pre-mRNA-splicing factor SPP382 | 6.82e-01 | NA | 0.030 |
| 3. B | A2VE39 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 9.17e-01 | NA | 7.33e-04 |
| 3. B | A1XD94 | Tuftelin-interacting protein 11 | 6.27e-01 | NA | 8.84e-05 |
| 3. B | Q02836 | Gag-Pol polyprotein | NA | NA | 0.010 |
| 3. B | Q9UBB9 | Tuftelin-interacting protein 11 | 9.32e-01 | NA | 8.76e-05 |
| 3. B | Q803R5 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 9.30e-01 | NA | 0.001 |
| 3. B | O89940 | Gag-Pol polyprotein | NA | NA | 0.013 |
| 3. B | P04587 | Gag-Pol polyprotein | NA | NA | 0.001 |
| 3. B | A4UMC5 | Tuftelin-interacting protein 11 | 9.28e-01 | NA | 7.96e-05 |
| 3. B | P12451 | Gag-Pol polyprotein | NA | NA | 3.52e-05 |
| 3. B | Q9DBC3 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 9.01e-01 | NA | 0.007 |
| 3. B | O91080 | Gag-Pol polyprotein | NA | NA | 0.036 |
| 3. B | P04584 | Gag-Pol polyprotein | NA | NA | 8.14e-07 |
| 3. B | Q5U2Y6 | Tuftelin-interacting protein 11 | 9.31e-01 | NA | 7.10e-05 |
| 3. B | P11283 | Gag-Pro-Pol polyprotein | NA | NA | 4.49e-16 |
| 3. B | Q9QBZ9 | Gag-Pol polyprotein | NA | NA | 5.67e-04 |
| 3. B | P03354 | Gag-Pol polyprotein | NA | NA | 6.56e-05 |
| 3. B | Q5R981 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 6.52e-01 | NA | 6.01e-04 |
| 3. B | P21407 | Gag-Pro polyprotein | NA | NA | 7.13e-29 |
| 3. B | P07572 | Gag-Pro-Pol polyprotein | NA | NA | 2.86e-26 |
| 3. B | Q1A267 | Gag-Pol polyprotein | NA | NA | 0.012 |
| 3. B | P26315 | Proteinase p15 | NA | NA | 1.85e-05 |
| 3. B | Q6GQ76 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 7.26e-01 | NA | 0.006 |
| 3. B | P11365 | Intracisternal A-particle Gag-related polyprotein | NA | NA | 1.39e-28 |
| 3. B | P04588 | Gag-Pol polyprotein | NA | NA | 0.002 |
| 3. B | Q8N1G2 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 6.60e-01 | NA | 6.01e-04 |
| 3. B | D2HRF1 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 9.10e-01 | NA | 8.06e-04 |
| 3. B | A4UMC6 | Tuftelin-interacting protein 11 | 8.83e-01 | NA | 5.44e-05 |
| 3. B | P12502 | Gag-Pol polyprotein | NA | NA | 0.001 |
| 3. B | P20875 | Gag-Pol polyprotein | NA | NA | 0.011 |
| 3. B | P17757 | Gag-Pol polyprotein | NA | NA | 2.38e-05 |
| 3. B | P15833 | Gag-Pol polyprotein | NA | NA | 1.31e-05 |
| 3. B | P51517 | Gag-Pro-Pol polyprotein | NA | NA | 3.31e-27 |
| 3. B | P12497 | Gag-Pol polyprotein | NA | NA | 0.001 |
| 3. B | P03322 | Gag polyprotein | NA | NA | 3.50e-05 |
| 3. B | P0C6F2 | Gag-Pol polyprotein | NA | NA | 0.001 |
| 3. B | P03369 | Gag-Pol polyprotein | NA | NA | 0.014 |
| 3. B | Q5ZII9 | Tuftelin-interacting protein 11 | 8.73e-01 | NA | 9.99e-05 |
| 3. B | P51518 | Gag-Pro polyprotein | NA | NA | 3.42e-27 |
| 3. B | P05896 | Gag-Pol polyprotein | NA | NA | 5.44e-05 |
| 3. B | P03366 | Gag-Pol polyprotein | NA | NA | 0.001 |
| 3. B | A8XYX3 | Inactive cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1B | 9.11e-01 | NA | 0.001 |
| 3. B | Q89928 | Gag-Pol polyprotein | NA | NA | 1.26e-06 |
| 3. B | Q9NAA5 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | 9.41e-01 | NA | 0.015 |
| 3. B | P18096 | Gag-Pol polyprotein | NA | NA | 4.56e-05 |
| 3. B | Q75002 | Gag-Pol polyprotein | NA | NA | 0.009 |
| 3. B | Q66J74 | Tuftelin-interacting protein 11 | 8.68e-01 | NA | 7.80e-05 |
| 3. B | P31625 | Gag-Pro polyprotein | NA | NA | 7.08e-30 |
| 3. B | A1XD93 | Tuftelin-interacting protein 11 | 8.89e-01 | NA | 8.84e-05 |
| 3. B | P32542 | Pol polyprotein | NA | NA | 4.18e-05 |
| 3. B | P24107 | Gag-Pol polyprotein | NA | NA | 1.43e-06 |
| 3. B | O12158 | Gag-Pol polyprotein | NA | NA | 3.99e-04 |
| 3. B | P63128 | Endogenous retrovirus group K member 9 Pol protein | 8.11e-04 | NA | 3.62e-101 |
| 3. B | Q9WC54 | Gag-Pol polyprotein | NA | NA | 0.002 |
| 3. B | P03365 | Gag-Pro-Pol polyprotein | NA | NA | 4.99e-16 |
| 3. B | P03371 | Pol polyprotein | NA | NA | 4.34e-05 |
| 3. B | Q9QSR3 | Gag-Pol polyprotein | NA | NA | 0.011 |
| 3. B | Q9QBZ1 | Gag-Pol polyprotein | NA | NA | 0.003 |
| 3. B | Q9SHG6 | Septin and tuftelin-interacting protein 1 homolog 1 | 9.65e-01 | NA | 0.006 |
| 3. B | P27973 | Gag-Pol polyprotein | NA | NA | 0.001 |
| 3. B | O92956 | Gag-Pol polyprotein | NA | NA | 4.46e-04 |
| 3. B | P05959 | Gag-Pol polyprotein | NA | NA | 6.12e-04 |
| 3. B | P17283 | Gag-Pol polyprotein | NA | NA | 0.034 |
| 3. B | Q7PYU6 | Zinc finger CCCH-type with G patch domain-containing protein | 5.16e-01 | NA | 0.008 |
| 3. B | P04023 | Intracisternal A-particle Gag-related polyprotein | NA | NA | 3.31e-12 |
| 3. B | Q9QBZ5 | Gag-Pol polyprotein | NA | NA | 0.005 |
| 3. B | P04025 | Gag-Pro-Pol polyprotein | NA | NA | 7.18e-27 |
| 3. B | P04585 | Gag-Pol polyprotein | NA | NA | 0.001 |
| 3. B | P31623 | Gag-Pro-Pol polyprotein | NA | NA | 3.60e-30 |
| 3. B | O93215 | Gag-Pol polyprotein | NA | NA | 0.002 |
| 3. B | Q79666 | Gag-Pol polyprotein | NA | NA | 0.038 |
| 3. B | P18042 | Gag-Pol polyprotein | NA | NA | 4.19e-04 |
| 3. B | A8XYX2 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1A | 8.37e-01 | NA | 0.004 |
| 3. B | Q04095 | Gag-Pol polyprotein | NA | NA | 1.85e-04 |
| 3. B | Q29RR5 | Tuftelin-interacting protein 11 | 9.20e-01 | NA | 7.45e-05 |
| 3. B | P18802 | Gag-Pol polyprotein | NA | NA | 0.003 |
| 3. B | P07570 | Gag-Pro polyprotein | NA | NA | 3.92e-26 |
| 3. B | P05962 | Gag-Pol polyprotein | NA | NA | 9.10e-05 |
| 3. B | O92954 | Gag polyprotein | NA | NA | 2.37e-04 |
| 3. B | P04024 | Gag-Pro polyprotein | NA | NA | 9.36e-27 |
| 3. B | P05897 | Gag-Pol polyprotein | NA | NA | 1.27e-05 |
| 3. B | Q9ERA6 | Tuftelin-interacting protein 11 | 6.93e-01 | NA | 6.71e-05 |
| 3. B | A1XD97 | Tuftelin-interacting protein 11 | 9.00e-01 | NA | 9.01e-05 |
| 3. B | Q8AII1 | Gag-Pol polyprotein | NA | NA | 2.81e-04 |
| 3. B | Q1A249 | Gag-Pol polyprotein | NA | NA | 0.025 |
| 3. B | P12499 | Gag-Pol polyprotein | NA | NA | 0.001 |