Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P86496
(Proline-rich protein 20A) with a FATCAT P-Value: 4.68e-09 and RMSD of 2.94 angstrom. The sequence alignment identity is 100.0%.
Structural alignment shown in left. Query protein P86481 colored as red in alignment, homolog P86496 colored as blue.
Query protein P86481 is also shown in right top, homolog P86496 showed in right bottom. They are colored based on secondary structures.
P86481 MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQPPARPESPPPAERGRRRGGSRRPGRGRGRRAGPRGDAGQ 100 P86496 MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQPPARPESPPPAERGRRRGGSRRPGRGRGRRAGPRGDAGQ 100 P86481 RQGAEGLMAPDVHIQLDHHGEPGHQGEPEITETAAFSLSETGPPPGTVQEGPGPDVAQPELGFQEPPAAPGPQAVDWQPVLTLYPCIGFRALGDSAVLQV 200 P86496 RQGAEGLMAPDVHIQLDHHGEPGHQGEPEITETAAFSLSETGPPPGTVQEGPGPDVAQPELGFQEPPAAPGPQAVDWQPVLTLYPCIGFRALGDSAVLQV 200 P86481 IQTPQGTYVQGVPVFLTDIAY 221 P86496 IQTPQGTYVQGVPVFLTDIAY 221
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0042025 | host cell nucleus |
| 2. P | GO:0009909 | regulation of flower development |
| 2. P | GO:0003700 | DNA-binding transcription factor activity |
| 2. P | GO:0000184 | nuclear-transcribed mRNA catabolic process, nonsense-mediated decay |
| 2. P | GO:0000976 | transcription cis-regulatory region binding |
| 2. P | GO:0039592 | suppression by virus of G2/M transition of host mitotic cell cycle |
| 2. P | GO:0010582 | floral meristem determinacy |
| 2. P | GO:0000932 | P-body |
| 2. P | GO:0030430 | host cell cytoplasm |
| 2. P | GO:0001669 | acrosomal vesicle |
| 3. B | GO:0001895 | retina homeostasis |
| 3. B | GO:0008377 | light-induced release of internally sequestered calcium ion |
| 3. B | GO:0098662 | inorganic cation transmembrane transport |
| 3. B | GO:0007605 | sensory perception of sound |
| 3. B | GO:0016028 | rhabdomere |
| 3. B | GO:0008104 | protein localization |
| 3. B | GO:0016027 | inaD signaling complex |
| 3. B | GO:0005262 | calcium channel activity |
| 3. B | GO:0007602 | phototransduction |
| 3. B | GO:0009416 | response to light stimulus |
| 3. B | GO:0006828 | manganese ion transport |
| 3. B | GO:0070588 | calcium ion transmembrane transport |
| 3. B | GO:0070679 | inositol 1,4,5 trisphosphate binding |
| 3. B | GO:0007603 | phototransduction, visible light |
| 3. B | GO:0007005 | mitochondrion organization |
| 3. B | GO:0015279 | store-operated calcium channel activity |
| 3. B | GO:0050962 | detection of light stimulus involved in sensory perception |
| 3. B | GO:0010461 | light-activated ion channel activity |
| 3. B | GO:0034703 | cation channel complex |
| 3. B | GO:0051480 | regulation of cytosolic calcium ion concentration |
| 3. B | GO:0006816 | calcium ion transport |
| 3. B | GO:0050908 | detection of light stimulus involved in visual perception |
| 3. B | GO:0035997 | rhabdomere microvillus membrane |
| 3. B | GO:0008355 | olfactory learning |
| 3. B | GO:0005516 | calmodulin binding |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0007608 | sensory perception of smell |
| 3. B | GO:0071454 | cellular response to anoxia |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P86478 | Proline-rich protein 20E | 5.13e-06 | 1.07e-151 | 2.01e-154 |
| 1. PB | P86481 | Proline-rich protein 20B | 0 | 1.07e-151 | 2.01e-154 |
| 1. PB | P86496 | Proline-rich protein 20A | 4.68e-09 | 1.07e-151 | 2.01e-154 |
| 1. PB | P0DPQ3 | Proline-rich protein 20G | 1.81e-02 | 3.22e-15 | 2.38e-41 |
| 1. PB | P86479 | Proline-rich protein 20C | 3.34e-05 | 1.07e-151 | 2.01e-154 |
| 1. PB | P86480 | Proline-rich protein 20D | 6.12e-03 | 1.07e-151 | 2.01e-154 |
| 2. P | Q0VFX4 | Putative uncharacterized protein LOC100128554 | 3.68e-01 | 4.32e-03 | NA |
| 2. P | Q9D9U4 | Testis-expressed protein 22 | 3.19e-01 | 8.93e-03 | NA |
| 2. P | Q9D4A5 | Uncharacterized protein C16orf86 homolog | 1.65e-01 | 3.40e-02 | NA |
| 2. P | Q84X40 | Protein SPEAR1 | 8.53e-02 | 3.43e-02 | NA |
| 2. P | B5X392 | Proline-rich nuclear receptor coactivator 2 | 2.53e-01 | 1.16e-02 | NA |
| 2. P | P06459 | Protein E4 | NA | 3.08e-02 | NA |
| 2. P | P51897 | Protein E4 | NA | 3.53e-02 | NA |
| 2. P | P51896 | Protein E4 | NA | 1.52e-02 | NA |
| 2. P | Q68D20 | Protein PMS2CL | 3.64e-02 | 3.02e-02 | NA |
| 2. P | Q9FFX4 | Zinc finger protein KNUCKLES | 1.80e-01 | 2.99e-02 | NA |
| 3. B | P19334 | Transient receptor potential protein | 9.64e-01 | NA | 0.008 |