Results | PROST

Summary

Q05C16

Homolog: Q6DHL5.
Function: Leucine-rich repeat-containing protein 57.

Statistics

Total GO Annotation: 407
Unique PROST Go: 41
Unique BLAST Go: 360

Total Homologs: 373
Unique PROST Homologs: 15
Unique BLAST Homologs: 349

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q6DHL5 (Leucine-rich repeat-containing protein 57) with a FATCAT P-Value: 2.84e-08 and RMSD of 2.22 angstrom. The sequence alignment identity is 13.3%.
Structural alignment shown in left. Query protein Q05C16 colored as red in alignment, homolog Q6DHL5 colored as blue. Query protein Q05C16 is also shown in right top, homolog Q6DHL5 showed in right bottom. They are colored based on secondary structures.

  Q05C16 MQKPPLLLRRPLPPKFTKLSLHEKKTHTAKTGKIESLHVAFTEDETTSIKMDRTRFPDVLRNQSLTPINIQNIFLDHCVQERVTAISSPQKSTKHVREQI 100
  Q6DHL5 ---------------------------------------------------------------------------------------------------- 0

  Q05C16 PDTATGSIFFPHCNSASTRIFGKQTNKMESSRKFKTMKDVYTEKRLENILILSSKFSKPKSTPGSVIAQKLEKMHPKHQPLPESPGYTYQHISRDLSATV 200
  Q6DHL5 ---------------------------------------------------------------------------------------------------- 0

  Q05C16 PSPPPMTVSMKPEGQWPEHFKSTATLTLRVTEFPGFVSLPTPVLPRKPHRQSVIETLVTENGNIESVPKQIPPRPPEGLTKTEKIESEIHVVRGEGFKTV 300
  Q6DHL5 ---------------------------------------------------------------------------------------------------- 0

  Q05C16 AATRYETITAMTNLAIVNCQVYGRNALNLKGFFILNCPDLTPLAFQLIYLNLSFNDLHYFPTEILCL-KNLQILKLRNNPIKEIPSEIQQLEFLRIFTIA 399
  Q6DHL5 ---------------------MGNSA--LKAH--LETSQKTGV-FQLTGKGLT--E---FPEDLQKLTANLRTVDLSNNKIEELPAFIGSFQHLKSFTIS 69

  Q05C16 FNLITVLP--IGLFSLSYLEELDVSYNELTFIPNEIQKLRSLEKLTVDGNELSFFPHGI--LK----LNLTKIQFENNFTHPCFWRDNYLNNPQQLTQI- 490
  Q6DHL5 CNKLTSLPNDIG--KLKKLETLILNGNQLKQLPSSIGQLKSLRTLSLSGNQFKEFPSGLGTLRQLDVLDLSK----NQI------R--VV--PAEVAELQ 153

  Q05C16 -ISLFIVQNKLHKF---YDKIPVEVQKLLKWGAQFLTELA--PLSIYS-SRKAI--TEGYIAVELPKFEESKNITEGLLTQKRYEEVMVKCINATTVTS- 580
  Q6DHL5 AIEINLNQNQISSVTQEVSRTP-RL-KVLRLEENCL-ELSSIPLSILTDSQVSLLSVEGNL-FEVKKMRD----LEG------YDKYMER----FTATKK 235

  Q05C16 --- 580
  Q6DHL5 KFA 238

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0030199	collagen fibril organization
1. PB	GO:0060348	bone development
1. PB	GO:0055046	microgametogenesis
1. PB	GO:0031012	extracellular matrix
1. PB	GO:0008201	heparin binding
1. PB	GO:0005518	collagen binding
2. P	GO:0030198	extracellular matrix organization
2. P	GO:0043014	alpha-tubulin binding
2. P	GO:0140278	mitotic division septum assembly
2. P	GO:0035591	signaling adaptor activity
2. P	GO:0051293	establishment of spindle localization
2. P	GO:0045132	meiotic chromosome segregation
2. P	GO:0007160	cell-matrix adhesion
2. P	GO:0007565	female pregnancy
2. P	GO:0009416	response to light stimulus
2. P	GO:0043153	entrainment of circadian clock by photoperiod
2. P	GO:0030953	astral microtubule organization
2. P	GO:0014033	neural crest cell differentiation
2. P	GO:0006515	protein quality control for misfolded or incompletely synthesized proteins
2. P	GO:0005201	extracellular matrix structural constituent
2. P	GO:0070052	collagen V binding
2. P	GO:0031028	septation initiation signaling
2. P	GO:0007399	nervous system development
2. P	GO:0019005	SCF ubiquitin ligase complex
2. P	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
2. P	GO:0008589	regulation of smoothened signaling pathway
2. P	GO:0061975	articular cartilage development
2. P	GO:0000073	initial mitotic spindle pole body separation
2. P	GO:0000209	protein polyubiquitination
2. P	GO:0016567	protein ubiquitination
2. P	GO:0045597	positive regulation of cell differentiation
2. P	GO:0007605	sensory perception of sound
2. P	GO:0000086	G2/M transition of mitotic cell cycle
2. P	GO:0005178	integrin binding
2. P	GO:0016525	negative regulation of angiogenesis
2. P	GO:0005576	extracellular region
2. P	GO:0009555	pollen development
2. P	GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
2. P	GO:0031536	positive regulation of exit from mitosis
2. P	GO:0051726	regulation of cell cycle
2. P	GO:0010811	positive regulation of cell-substrate adhesion
2. P	GO:0005539	glycosaminoglycan binding
2. P	GO:0061499	outer plaque of mitotic spindle pole body
2. P	GO:0045504	dynein heavy chain binding
2. P	GO:1902412	regulation of mitotic cytokinesis
2. P	GO:0044732	mitotic spindle pole body
2. P	GO:0005614	interstitial matrix
3. B	GO:0010449	root meristem growth
3. B	GO:0030014	CCR4-NOT complex
3. B	GO:0042277	peptide binding
3. B	GO:0009729	detection of brassinosteroid stimulus
3. B	GO:0016080	synaptic vesicle targeting
3. B	GO:0030837	negative regulation of actin filament polymerization
3. B	GO:0046007	negative regulation of activated T cell proliferation
3. B	GO:0070848	response to growth factor
3. B	GO:0045571	negative regulation of imaginal disc growth
3. B	GO:0090037	positive regulation of protein kinase C signaling
3. B	GO:2001013	epithelial cell proliferation involved in renal tubule morphogenesis
3. B	GO:0006368	transcription elongation from RNA polymerase II promoter
3. B	GO:0007089	traversing start control point of mitotic cell cycle
3. B	GO:0002237	response to molecule of bacterial origin
3. B	GO:0002718	regulation of cytokine production involved in immune response
3. B	GO:0099147	extrinsic component of postsynaptic density membrane
3. B	GO:0006884	cell volume homeostasis
3. B	GO:0043615	astrocyte cell migration
3. B	GO:0045186	zonula adherens assembly
3. B	GO:0061161	positive regulation of establishment of bipolar cell polarity regulating cell shape
3. B	GO:0005095	GTPase inhibitor activity
3. B	GO:0036360	sorocarp stalk morphogenesis
3. B	GO:0030539	male genitalia development
3. B	GO:0048281	inflorescence morphogenesis
3. B	GO:0010069	zygote asymmetric cytokinesis in embryo sac
3. B	GO:0060412	ventricular septum morphogenesis
3. B	GO:0015734	taurine transport
3. B	GO:0071470	cellular response to osmotic stress
3. B	GO:0090406	pollen tube
3. B	GO:0030426	growth cone
3. B	GO:0045663	positive regulation of myoblast differentiation
3. B	GO:1904417	positive regulation of xenophagy
3. B	GO:0071672	negative regulation of smooth muscle cell chemotaxis
3. B	GO:0019903	protein phosphatase binding
3. B	GO:0106310	protein serine kinase activity
3. B	GO:0010103	stomatal complex morphogenesis
3. B	GO:0016500	protein-hormone receptor activity
3. B	GO:0048495	Roundabout binding
3. B	GO:0008330	protein tyrosine/threonine phosphatase activity
3. B	GO:0005615	extracellular space
3. B	GO:0043116	negative regulation of vascular permeability
3. B	GO:0007163	establishment or maintenance of cell polarity
3. B	GO:0071221	cellular response to bacterial lipopeptide
3. B	GO:0099061	integral component of postsynaptic density membrane
3. B	GO:0004722	protein serine/threonine phosphatase activity
3. B	GO:0060581	cell fate commitment involved in pattern specification
3. B	GO:0006954	inflammatory response
3. B	GO:0072282	metanephric nephron tubule morphogenesis
3. B	GO:0051489	regulation of filopodium assembly
3. B	GO:0106307
3. B	GO:0030054	cell junction
3. B	GO:0048508	embryonic meristem development
3. B	GO:0030587	sorocarp development
3. B	GO:0015698	inorganic anion transport
3. B	GO:0001657	ureteric bud development
3. B	GO:0002667	regulation of T cell anergy
3. B	GO:0032433	filopodium tip
3. B	GO:0000288	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
3. B	GO:0045930	negative regulation of mitotic cell cycle
3. B	GO:0007283	spermatogenesis
3. B	GO:0002329	pre-B cell differentiation
3. B	GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane
3. B	GO:2000786	positive regulation of autophagosome assembly
3. B	GO:0000076	DNA replication checkpoint signaling
3. B	GO:0043231	intracellular membrane-bounded organelle
3. B	GO:0002764	immune response-regulating signaling pathway
3. B	GO:0010606	positive regulation of cytoplasmic mRNA processing body assembly
3. B	GO:0045108	regulation of intermediate filament polymerization or depolymerization
3. B	GO:0070100	negative regulation of chemokine-mediated signaling pathway
3. B	GO:0005886	plasma membrane
3. B	GO:0001768	establishment of T cell polarity
3. B	GO:1905606	regulation of presynapse assembly
3. B	GO:0070966	nuclear-transcribed mRNA catabolic process, no-go decay
3. B	GO:0006970	response to osmotic stress
3. B	GO:0030714	anterior/posterior axis specification, follicular epithelium
3. B	GO:0140360	cyclic-GMP-AMP transmembrane transporter activity
3. B	GO:0032588	trans-Golgi network membrane
3. B	GO:0019199	transmembrane receptor protein kinase activity
3. B	GO:0070086	ubiquitin-dependent endocytosis
3. B	GO:0010596	negative regulation of endothelial cell migration
3. B	GO:0016336	establishment or maintenance of polarity of larval imaginal disc epithelium
3. B	GO:0050929	induction of negative chemotaxis
3. B	GO:0030282	bone mineralization
3. B	GO:0016332	establishment or maintenance of polarity of embryonic epithelium
3. B	GO:0005176	ErbB-2 class receptor binding
3. B	GO:0048839	inner ear development
3. B	GO:0090548	response to nitrate starvation
3. B	GO:0010233	phloem transport
3. B	GO:0034142	toll-like receptor 4 signaling pathway
3. B	GO:2000280	regulation of root development
3. B	GO:0008045	motor neuron axon guidance
3. B	GO:0034750	Scrib-APC-beta-catenin complex
3. B	GO:0099560	synaptic membrane adhesion
3. B	GO:1902476	chloride transmembrane transport
3. B	GO:0007601	visual perception
3. B	GO:0030239	myofibril assembly
3. B	GO:0042659	regulation of cell fate specification
3. B	GO:1905103	integral component of lysosomal membrane
3. B	GO:0005887	integral component of plasma membrane
3. B	GO:0021972	corticospinal neuron axon guidance through spinal cord
3. B	GO:0009742	brassinosteroid mediated signaling pathway
3. B	GO:0003181	atrioventricular valve morphogenesis
3. B	GO:0031589	cell-substrate adhesion
3. B	GO:0045175	basal protein localization
3. B	GO:0030056	hemidesmosome
3. B	GO:0090038	negative regulation of protein kinase C signaling
3. B	GO:0071676	negative regulation of mononuclear cell migration
3. B	GO:0098968	neurotransmitter receptor transport postsynaptic membrane to endosome
3. B	GO:0033563	dorsal/ventral axon guidance
3. B	GO:0002224	toll-like receptor signaling pathway
3. B	GO:0002689	negative regulation of leukocyte chemotaxis
3. B	GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity
3. B	GO:0004532	exoribonuclease activity
3. B	GO:0051014	actin filament severing
3. B	GO:0034130	toll-like receptor 1 signaling pathway
3. B	GO:0035385	Roundabout signaling pathway
3. B	GO:0060561	apoptotic process involved in morphogenesis
3. B	GO:0044291	cell-cell contact zone
3. B	GO:0005789	endoplasmic reticulum membrane
3. B	GO:0072202	cell differentiation involved in metanephros development
3. B	GO:0006952	defense response
3. B	GO:0008157	protein phosphatase 1 binding
3. B	GO:0099139	cheating during chimeric sorocarp development
3. B	GO:0002758	innate immune response-activating signal transduction
3. B	GO:0006171	cAMP biosynthetic process
3. B	GO:0005199	structural constituent of cell wall
3. B	GO:0051015	actin filament binding
3. B	GO:0003184	pulmonary valve morphogenesis
3. B	GO:0004672	protein kinase activity
3. B	GO:0043531	ADP binding
3. B	GO:0010067	procambium histogenesis
3. B	GO:0008528	G protein-coupled peptide receptor activity
3. B	GO:0043030	regulation of macrophage activation
3. B	GO:0010148	transpiration
3. B	GO:0010359	regulation of anion channel activity
3. B	GO:0048812	neuron projection morphogenesis
3. B	GO:0021510	spinal cord development
3. B	GO:0000188	obsolete inactivation of MAPK activity
3. B	GO:0009649	entrainment of circadian clock
3. B	GO:0005583	fibrillar collagen trimer
3. B	GO:0021836	chemorepulsion involved in postnatal olfactory bulb interneuron migration
3. B	GO:0010183	pollen tube guidance
3. B	GO:0060088	auditory receptor cell stereocilium organization
3. B	GO:0035354	Toll-like receptor 1-Toll-like receptor 2 protein complex
3. B	GO:0051393	alpha-actinin binding
3. B	GO:0010078	maintenance of root meristem identity
3. B	GO:0043928	exonucleolytic catabolism of deadenylated mRNA
3. B	GO:1903077	negative regulation of protein localization to plasma membrane
3. B	GO:0061290	canonical Wnt signaling pathway involved in metanephric kidney development
3. B	GO:0060763	mammary duct terminal end bud growth
3. B	GO:0032495	response to muramyl dipeptide
3. B	GO:0106311
3. B	GO:0098609	cell-cell adhesion
3. B	GO:0014069	postsynaptic density
3. B	GO:0050673	epithelial cell proliferation
3. B	GO:0033612	receptor serine/threonine kinase binding
3. B	GO:0001818	negative regulation of cytokine production
3. B	GO:0016607	nuclear speck
3. B	GO:0014912	negative regulation of smooth muscle cell migration
3. B	GO:0005496	steroid binding
3. B	GO:0016045	detection of bacterium
3. B	GO:0106306
3. B	GO:0036335	intestinal stem cell homeostasis
3. B	GO:0034137	positive regulation of toll-like receptor 2 signaling pathway
3. B	GO:0043327	chemotaxis to cAMP
3. B	GO:0035970	peptidyl-threonine dephosphorylation
3. B	GO:0030017	sarcomere
3. B	GO:0051414	response to cortisol
3. B	GO:0007318	pole plasm protein localization
3. B	GO:0030374	nuclear receptor coactivator activity
3. B	GO:0090288	negative regulation of cellular response to growth factor stimulus
3. B	GO:0032922	circadian regulation of gene expression
3. B	GO:0035089	establishment of apical/basal cell polarity
3. B	GO:0031290	retinal ganglion cell axon guidance
3. B	GO:0032968	positive regulation of transcription elongation from RNA polymerase II promoter
3. B	GO:0140361	cyclic-GMP-AMP transmembrane import across plasma membrane
3. B	GO:0051898	negative regulation of protein kinase B signaling
3. B	GO:1900140	regulation of seedling development
3. B	GO:0032914	positive regulation of transforming growth factor beta1 production
3. B	GO:0016333	morphogenesis of follicular epithelium
3. B	GO:0034123	positive regulation of toll-like receptor signaling pathway
3. B	GO:0007265	Ras protein signal transduction
3. B	GO:0007409	axonogenesis
3. B	GO:0060603	mammary gland duct morphogenesis
3. B	GO:0090263	positive regulation of canonical Wnt signaling pathway
3. B	GO:0051058	negative regulation of small GTPase mediated signal transduction
3. B	GO:0030517	negative regulation of axon extension
3. B	GO:1900744	regulation of p38MAPK cascade
3. B	GO:0071504	cellular response to heparin
3. B	GO:0043237	laminin-1 binding
3. B	GO:0022028	tangential migration from the subventricular zone to the olfactory bulb
3. B	GO:0031430	M band
3. B	GO:0001737	establishment of imaginal disc-derived wing hair orientation
3. B	GO:0035308	negative regulation of protein dephosphorylation
3. B	GO:0061809	NAD+ nucleotidase, cyclic ADP-ribose generating
3. B	GO:0007190	activation of adenylate cyclase activity
3. B	GO:0090260	negative regulation of retinal ganglion cell axon guidance
3. B	GO:0043194	axon initial segment
3. B	GO:0046849	bone remodeling
3. B	GO:0071896	protein localization to adherens junction
3. B	GO:0009986	cell surface
3. B	GO:0001942	hair follicle development
3. B	GO:0030859	polarized epithelial cell differentiation
3. B	GO:0007165	signal transduction
3. B	GO:0048846	axon extension involved in axon guidance
3. B	GO:0034702	ion channel complex
3. B	GO:0051270	regulation of cellular component movement
3. B	GO:0007097	nuclear migration
3. B	GO:0072002	Malpighian tubule development
3. B	GO:0048843	negative regulation of axon extension involved in axon guidance
3. B	GO:0050919	negative chemotaxis
3. B	GO:0034144	negative regulation of toll-like receptor 4 signaling pathway
3. B	GO:0098978	glutamatergic synapse
3. B	GO:0048226	Casparian strip
3. B	GO:0055013	cardiac muscle cell development
3. B	GO:0009626	plant-type hypersensitive response
3. B	GO:0042495	detection of triacyl bacterial lipopeptide
3. B	GO:0060866	leaf abscission
3. B	GO:0016020	membrane
3. B	GO:0007527	adult somatic muscle development
3. B	GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
3. B	GO:0016323	basolateral plasma membrane
3. B	GO:0009942	longitudinal axis specification
3. B	GO:0097120	receptor localization to synapse
3. B	GO:0046813	receptor-mediated virion attachment to host cell
3. B	GO:0043031	negative regulation of macrophage activation
3. B	GO:1990523	bone regeneration
3. B	GO:0004535	poly(A)-specific ribonuclease activity
3. B	GO:0030308	negative regulation of cell growth
3. B	GO:0010004	gastrulation involving germ band extension
3. B	GO:0070433	negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway
3. B	GO:0004674	protein serine/threonine kinase activity
3. B	GO:0043394	proteoglycan binding
3. B	GO:0048657	anther wall tapetum cell differentiation
3. B	GO:2000405	negative regulation of T cell migration
3. B	GO:0002042	cell migration involved in sprouting angiogenesis
3. B	GO:0021772	olfactory bulb development
3. B	GO:0042622	photoreceptor outer segment membrane
3. B	GO:0021747	cochlear nucleus development
3. B	GO:1990869	cellular response to chemokine
3. B	GO:0009755	hormone-mediated signaling pathway
3. B	GO:0006470	protein dephosphorylation
3. B	GO:0048813	dendrite morphogenesis
3. B	GO:0000932	P-body
3. B	GO:0001649	osteoblast differentiation
3. B	GO:0048565	digestive tract development
3. B	GO:0045087	innate immune response
3. B	GO:0035335	peptidyl-tyrosine dephosphorylation
3. B	GO:0016334	establishment or maintenance of polarity of follicular epithelium
3. B	GO:0051897	positive regulation of protein kinase B signaling
3. B	GO:0120163	negative regulation of cold-induced thermogenesis
3. B	GO:0071638	negative regulation of monocyte chemotactic protein-1 production
3. B	GO:1900181	negative regulation of protein localization to nucleus
3. B	GO:0031047	gene silencing by RNA
3. B	GO:0032870	cellular response to hormone stimulus
3. B	GO:0034166	toll-like receptor 10 signaling pathway
3. B	GO:0046755	viral budding
3. B	GO:0030015	CCR4-NOT core complex
3. B	GO:0005912	adherens junction
3. B	GO:0099072	regulation of postsynaptic membrane neurotransmitter receptor levels
3. B	GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors
3. B	GO:0004675	transmembrane receptor protein serine/threonine kinase activity
3. B	GO:0031150	sorocarp stalk development
3. B	GO:0003180	aortic valve morphogenesis
3. B	GO:0015810	aspartate transmembrane transport
3. B	GO:0008154	actin polymerization or depolymerization
3. B	GO:0007411	axon guidance
3. B	GO:0051964	negative regulation of synapse assembly
3. B	GO:0035748	myelin sheath abaxonal region
3. B	GO:0034122	negative regulation of toll-like receptor signaling pathway
3. B	GO:0030500	regulation of bone mineralization
3. B	GO:0050918	positive chemotaxis
3. B	GO:0016791	phosphatase activity
3. B	GO:1900155	negative regulation of bone trabecula formation
3. B	GO:0010087	phloem or xylem histogenesis
3. B	GO:0021888	hypothalamus gonadotrophin-releasing hormone neuron development
3. B	GO:0005225	volume-sensitive anion channel activity
3. B	GO:0001678	cellular glucose homeostasis
3. B	GO:0043236	laminin binding
3. B	GO:0038187	pattern recognition receptor activity
3. B	GO:0045806	negative regulation of endocytosis
3. B	GO:0090696	post-embryonic plant organ development
3. B	GO:0036289	peptidyl-serine autophosphorylation
3. B	GO:0000175	3'-5'-exoribonuclease activity
3. B	GO:0062200	RAM/MOR signaling pathway
3. B	GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity
3. B	GO:0004016	adenylate cyclase activity
3. B	GO:0016335	morphogenesis of larval imaginal disc epithelium
3. B	GO:0050728	negative regulation of inflammatory response
3. B	GO:0048478	replication fork protection
3. B	GO:0030027	lamellipodium
3. B	GO:0043065	positive regulation of apoptotic process
3. B	GO:0035996	rhabdomere microvillus
3. B	GO:0032185	septin cytoskeleton organization
3. B	GO:0000287	magnesium ion binding
3. B	GO:0061364	apoptotic process involved in luteolysis
3. B	GO:0034136	negative regulation of toll-like receptor 2 signaling pathway
3. B	GO:0045444	fat cell differentiation
3. B	GO:0009945	radial axis specification
3. B	GO:0090190	positive regulation of branching involved in ureteric bud morphogenesis
3. B	GO:2000067	regulation of root morphogenesis
3. B	GO:0036342	post-anal tail morphogenesis
3. B	GO:0050135	NAD(P)+ nucleosidase activity
3. B	GO:0035663	Toll-like receptor 2 binding
3. B	GO:0043408	regulation of MAPK cascade
3. B	GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling
3. B	GO:0010619	adenylate cyclase-activating glucose-activated G protein-coupled receptor signaling pathway
3. B	GO:0004721	phosphoprotein phosphatase activity
3. B	GO:0001530	lipopolysaccharide binding
3. B	GO:0043395	heparan sulfate proteoglycan binding
3. B	GO:0090024	negative regulation of neutrophil chemotaxis
3. B	GO:0072224	metanephric glomerulus development
3. B	GO:0051019	mitogen-activated protein kinase binding
3. B	GO:0001921	positive regulation of receptor recycling
3. B	GO:0046328	regulation of JNK cascade
3. B	GO:1905421	regulation of plant organ morphogenesis
3. B	GO:0009994	oocyte differentiation
3. B	GO:0016593	Cdc73/Paf1 complex
3. B	GO:0010593	negative regulation of lamellipodium assembly
3. B	GO:0048884	neuromast development
3. B	GO:0099149	regulation of postsynaptic neurotransmitter receptor internalization
3. B	GO:0035580	specific granule lumen
3. B	GO:0090708	specification of plant organ axis polarity
3. B	GO:0043113	receptor clustering
3. B	GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening
3. B	GO:0034214	protein hexamerization
3. B	GO:0098656	anion transmembrane transport
3. B	GO:0010070	zygote asymmetric cell division
3. B	GO:0046696	lipopolysaccharide receptor complex
3. B	GO:0010082	regulation of root meristem growth
3. B	GO:0030833	regulation of actin filament polymerization
3. B	GO:0002093	auditory receptor cell morphogenesis
3. B	GO:0090027	negative regulation of monocyte chemotaxis
3. B	GO:0016331	morphogenesis of embryonic epithelium
3. B	GO:0042067	establishment of ommatidial planar polarity
3. B	GO:0046579	positive regulation of Ras protein signal transduction
3. B	GO:0001653	peptide receptor activity
3. B	GO:0002755	MyD88-dependent toll-like receptor signaling pathway
3. B	GO:0051302	regulation of cell division
3. B	GO:0045499	chemorepellent activity
3. B	GO:0006820	anion transport
3. B	GO:0051016	barbed-end actin filament capping
3. B	GO:0048754	branching morphogenesis of an epithelial tube
3. B	GO:0099151	regulation of postsynaptic density assembly
3. B	GO:1903224	regulation of endodermal cell differentiation
3. B	GO:0003779	actin binding
3. B	GO:0062023	collagen-containing extracellular matrix
3. B	GO:0004888	transmembrane signaling receptor activity
3. B	GO:0005546	phosphatidylinositol-4,5-bisphosphate binding
3. B	GO:0042645	mitochondrial nucleoid
3. B	GO:0001656	metanephros development
3. B	GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
3. B	GO:0032024	positive regulation of insulin secretion
3. B	GO:0000164	protein phosphatase type 1 complex
3. B	GO:0022029	telencephalon cell migration
3. B	GO:0010074	maintenance of meristem identity
3. B	GO:0035239	tube morphogenesis
3. B	GO:0034163	regulation of toll-like receptor 9 signaling pathway
3. B	GO:0032088	negative regulation of NF-kappaB transcription factor activity
3. B	GO:0003785	actin monomer binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q9SVW8	Plant intracellular Ras-group-related LRR protein 4	2.63e-03	1.73e-03	2.89e-08
1. PB	Q9FFJ3	Plant intracellular Ras-group-related LRR protein 1	1.46e-03	1.20e-06	8.20e-08
1. PB	Q8VYG9	Plant intracellular Ras-group-related LRR protein 9	1.23e-03	4.27e-05	4.19e-11
1. PB	Q6Z8P4	Plant intracellular Ras-group-related LRR protein 4	4.16e-04	2.43e-03	1.96e-09
1. PB	Q5G5E0	Plant intracellular Ras-group-related LRR protein 5	5.13e-04	9.50e-03	1.45e-08
1. PB	A6H694	Leucine-rich repeat-containing protein 63	1.51e-05	1.44e-33	7.94e-140
1. PB	Q96L50	Leucine-rich repeat protein 1	3.42e-04	4.60e-03	8.59e-05
1. PB	Q05C16	Leucine-rich repeat-containing protein 63	0	7.73e-143	0.0
1. PB	Q4V8G0	Leucine-rich repeat-containing protein 63	5.92e-04	4.97e-39	3.18e-138
2. P	Q5FW85	Extracellular matrix protein 2	2.84e-02	4.62e-05	NA
2. P	Q3MHH9	Extracellular matrix protein 2	3.50e-03	8.25e-04	NA
2. P	P32336	Protein NUD1	2.67e-02	4.56e-10	NA
2. P	Q9UF56	F-box/LRR-repeat protein 17	1.94e-02	4.04e-02	NA
2. P	Q99645	Epiphycan	3.09e-03	1.71e-02	NA
2. P	G5EDE9	ANK repeat-containing protein nipk-1	2.21e-01	2.30e-02	NA
2. P	P83286	Opticin	3.34e-03	1.93e-02	NA
2. P	Q90944	Epiphycan	4.50e-03	9.92e-04	NA
2. P	P70186	Epiphycan	2.30e-03	2.18e-02	NA
2. P	Q9QZN1	F-box/LRR-repeat protein 17	3.69e-02	3.24e-02	NA
2. P	Q96QE4	Leucine-rich repeat-containing protein 37B	8.54e-03	1.29e-07	NA
2. P	O94769	Extracellular matrix protein 2	2.72e-02	1.01e-05	NA
2. P	Q920A0	Opticin	1.05e-03	3.68e-03	NA
2. P	O74473	Septation initiation network scaffold protein cdc11	3.79e-02	4.02e-09	NA
2. P	Q9UBM4	Opticin	4.77e-03	1.64e-03	NA
3. B	A4IHG1	Leucine-rich repeat-containing protein 58	3.88e-04	NA	1.45e-07
3. B	Q54XZ5	Probable serine/threonine-protein kinase DDB_G0278509	2.21e-02	NA	1.58e-04
3. B	F4JTU7	Receptor-like protein 48	6.87e-02	NA	0.024
3. B	Q9FII5	Leucine-rich repeat receptor-like protein kinase TDR	3.84e-02	NA	0.031
3. B	P0CP22	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.56e-02	NA	0.002
3. B	O46379	Lumican (Fragment)	1.74e-06	NA	0.005
3. B	Q8VEG6	CCR4-NOT transcription complex subunit 6-like	1.78e-02	NA	0.026
3. B	O75094	Slit homolog 3 protein	1.48e-01	NA	2.15e-05
3. B	Q75BI3	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	7.01e-02	NA	0.017
3. B	Q32NT4	Leucine-rich repeat-containing protein 58	2.91e-04	NA	8.37e-09
3. B	Q9BYS8	Leucine-rich repeat-containing protein 2	2.05e-04	NA	1.14e-08
3. B	Q24020	Protein flightless-1	3.65e-02	NA	1.94e-06
3. B	Q8AVI4	Leucine-rich repeat protein SHOC-2	6.42e-03	NA	8.94e-11
3. B	B4IBI9	Leucine-rich repeat protein soc-2 homolog	2.69e-02	NA	1.01e-12
3. B	Q6GR35	Protein Abitram	9.65e-01	NA	1.50e-10
3. B	Q9VJ07	Protein phosphatase PHLPP-like protein	9.48e-02	NA	4.71e-04
3. B	Q2UUI3	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	3.87e-02	NA	0.003
3. B	Q5RFE9	Leucine-rich repeat-containing protein 40	2.97e-03	NA	9.72e-09
3. B	Q7XK44	Plant intracellular Ras-group-related LRR protein 3	1.32e-04	NA	5.20e-08
3. B	Q5E9X4	Leucine-rich repeat-containing protein 59	1.16e-03	NA	0.007
3. B	B5UBC1	Disease resistance protein Pikm1-TS	5.50e-02	NA	2.19e-08
3. B	Q9LRV8	Plant intracellular Ras-group-related LRR protein 2	2.06e-04	NA	1.14e-14
3. B	O75427	Leucine-rich repeat and calponin homology domain-containing protein 4	8.32e-04	NA	5.97e-09
3. B	Q5VUJ6	Leucine-rich repeat and calponin homology domain-containing protein 2	8.71e-04	NA	1.96e-09
3. B	P51885	Lumican	4.30e-03	NA	0.022
3. B	Q7SXW3	Leucine-rich repeat-containing protein 40	1.79e-03	NA	1.04e-09
3. B	O93233	Phospholipase A2 inhibitor	1.36e-03	NA	0.001
3. B	Q96RT1	Erbin	9.02e-02	NA	9.42e-09
3. B	Q5G5D8	Plant intracellular Ras-group-related LRR protein 7	2.64e-04	NA	2.03e-07
3. B	Q8L899	Systemin receptor SR160	1.37e-01	NA	1.30e-05
3. B	Q6FRT2	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.13e-02	NA	1.19e-04
3. B	Q3UMG5	Leucine-rich repeat and calponin homology domain-containing protein 2	5.86e-03	NA	1.27e-09
3. B	Q3V1N1	Malignant fibrous histiocytoma-amplified sequence 1 homolog	1.13e-02	NA	1.62e-09
3. B	Q80YS5	Leucine-rich repeat-containing protein 27	5.36e-03	NA	6.41e-04
3. B	O88520	Leucine-rich repeat protein SHOC-2	2.91e-03	NA	1.06e-11
3. B	A6NM36	Leucine-rich repeat-containing protein 30	2.75e-04	NA	2.49e-07
3. B	Q6K7R2	Plant intracellular Ras-group-related LRR protein 6	5.51e-04	NA	1.29e-04
3. B	Q4UWF4	Uridine 5'-monophosphate transferase	6.07e-04	NA	0.002
3. B	Q15399	Toll-like receptor 1	2.18e-02	NA	0.030
3. B	B0BLW3	Leucine-rich repeat-containing G-protein coupled receptor 4	2.29e-02	NA	0.016
3. B	Q9SHI2	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	6.95e-02	NA	0.016
3. B	P14605	Adenylate cyclase	8.21e-02	NA	2.17e-06
3. B	Q9WVC1	Slit homolog 2 protein (Fragment)	7.51e-03	NA	0.027
3. B	Q9Z1P4	Leucine-rich repeat-containing G-protein coupled receptor 5	3.33e-02	NA	0.002
3. B	Q4H4B6	Protein scribble homolog	9.54e-02	NA	9.33e-07
3. B	C0LGT6	LRR receptor-like serine/threonine-protein kinase EFR	2.61e-02	NA	0.003
3. B	Q6GPJ5	Leucine-rich repeat-containing protein 40	5.36e-03	NA	4.48e-11
3. B	Q8TF66	Leucine-rich repeat-containing protein 15	6.89e-03	NA	0.031
3. B	B5DX45	Leucine-rich repeat protein soc-2 homolog	8.74e-04	NA	1.63e-12
3. B	Q6DHL5	Leucine-rich repeat-containing protein 57	2.84e-08	NA	3.28e-10
3. B	Q55CS7	MAP kinase phosphatase with leucine-rich repeats protein 1	1.05e-02	NA	2.22e-04
3. B	O15335	Chondroadherin	4.15e-03	NA	5.71e-05
3. B	O55226	Chondroadherin	2.97e-03	NA	2.95e-04
3. B	Q42371	LRR receptor-like serine/threonine-protein kinase ERECTA	1.29e-02	NA	2.44e-05
3. B	Q9RBS2	Protein PopC	7.31e-02	NA	7.72e-05
3. B	Q9HB75	p53-induced death domain-containing protein 1	3.63e-02	NA	2.90e-11
3. B	Q3UHC2	Leucine-rich repeat serine/threonine-protein kinase 1	2.49e-01	NA	0.007
3. B	B4N9T4	Leucine-rich repeat protein soc-2 homolog	1.10e-03	NA	2.03e-12
3. B	A1CW67	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.69e-02	NA	0.034
3. B	Q3UV48	Leucine-rich repeat-containing protein 30	4.32e-04	NA	2.84e-08
3. B	Q3KQF4	Leucine-rich repeat-containing protein 69	1.50e-05	NA	6.51e-09
3. B	Q9BTT6	Leucine-rich repeat-containing protein 1	6.16e-04	NA	2.19e-08
3. B	B3P3E8	Leucine-rich repeat protein soc-2 homolog	2.51e-04	NA	8.45e-13
3. B	F1MCA7	Leucine-rich repeat-containing protein 7	9.80e-02	NA	1.05e-09
3. B	Q24K06	Leucine-rich repeat-containing protein 10	2.51e-05	NA	4.35e-11
3. B	Q9LY03	Probable LRR receptor-like serine/threonine-protein kinase IRK	4.90e-02	NA	5.55e-04
3. B	P0C7J6	Leucine-rich repeat and fibronectin type III domain-containing protein 1	1.27e-02	NA	0.003
3. B	Q9NR96	Toll-like receptor 9	3.31e-02	NA	0.028
3. B	A8JAM0	Dynein regulatory complex subunit 7 (Fragment)	4.69e-03	NA	5.02e-12
3. B	Q4R6F0	Leucine-rich repeat and death domain-containing protein 1	2.90e-03	NA	1.69e-12
3. B	Q96NW7	Leucine-rich repeat-containing protein 7	1.67e-01	NA	1.74e-09
3. B	Q6UWE0	E3 ubiquitin-protein ligase LRSAM1	1.12e-04	NA	1.68e-07
3. B	Q6JN47	Receptor-like protein EIX1	3.99e-02	NA	0.012
3. B	F1MLX5	Leucine-rich repeat-containing G-protein coupled receptor 4	4.19e-02	NA	0.002
3. B	Q27972	Chondroadherin	NA	NA	1.17e-04
3. B	F4HX15	Phospholipase A I	1.30e-01	NA	5.72e-04
3. B	Q8BVU0	DISP complex protein LRCH3	1.45e-03	NA	7.12e-08
3. B	Q2WF71	Leucine-rich repeat and fibronectin type III domain-containing protein 1	9.35e-02	NA	0.003
3. B	Q8TDW0	Volume-regulated anion channel subunit LRRC8C	6.75e-03	NA	3.98e-08
3. B	Q15404	Ras suppressor protein 1	3.03e-08	NA	6.33e-12
3. B	Q8BGR2	Volume-regulated anion channel subunit LRRC8D	6.30e-02	NA	4.12e-08
3. B	Q55FD8	Ras guanine nucleotide exchange factor V	1.06e-01	NA	3.56e-07
3. B	Q5M8G4	Leucine-rich repeat-containing protein 40	1.11e-03	NA	3.48e-10
3. B	Q9BXB1	Leucine-rich repeat-containing G-protein coupled receptor 4	3.83e-02	NA	0.003
3. B	E5DHB5	Leucine-rich repeat-containing G-protein coupled receptor 5A	2.01e-02	NA	7.57e-04
3. B	A8XWW4	Leucine-rich repeat protein soc-2	1.87e-03	NA	8.83e-08
3. B	Q55CS8	MAP kinase phosphatase with leucine-rich repeats protein 2	7.62e-03	NA	1.88e-04
3. B	Q505F5	Leucine-rich repeat-containing protein 47	4.22e-03	NA	3.36e-05
3. B	Q96AG4	Leucine-rich repeat-containing protein 59	1.10e-03	NA	0.014
3. B	Q55E58	Probable serine/threonine-protein kinase pats1	NA	NA	1.52e-08
3. B	Q54Y32	MAP kinase phosphatase with leucine-rich repeats protein 3	2.02e-03	NA	2.27e-04
3. B	A2ARI4	Leucine-rich repeat-containing G-protein coupled receptor 4	1.86e-02	NA	1.48e-04
3. B	Q5ZLN0	Leucine-rich repeat-containing protein 40	2.66e-03	NA	4.13e-09
3. B	Q6NU09	Volume-regulated anion channel subunit LRRC8E	4.18e-02	NA	1.60e-06
3. B	Q810B8	SLIT and NTRK-like protein 4	2.03e-02	NA	0.023
3. B	Q9C0I9	Leucine-rich repeat-containing protein 27	2.45e-02	NA	0.011
3. B	Q01730	Ras suppressor protein 1	3.35e-07	NA	1.72e-09
3. B	B7XK66	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.97e-03	NA	8.08e-06
3. B	P07359	Platelet glycoprotein Ib alpha chain	1.04e-02	NA	1.95e-04
3. B	Q9LJF3	Receptor-like protein kinase BRI1-like 3	NA	NA	0.010
3. B	P70587	Leucine-rich repeat-containing protein 7	1.07e-01	NA	4.25e-09
3. B	Q9WTR8	PH domain leucine-rich repeat protein phosphatase 1	1.49e-01	NA	4.34e-10
3. B	Q22875	Leucine-rich repeat protein soc-2	4.74e-03	NA	4.45e-08
3. B	B4PU77	Leucine-rich repeat protein soc-2 homolog	1.61e-03	NA	8.69e-13
3. B	Q7XA40	Putative disease resistance protein RGA3	4.15e-02	NA	0.004
3. B	Q6NSJ5	Volume-regulated anion channel subunit LRRC8E	5.69e-03	NA	7.07e-08
3. B	Q8N9N7	Leucine-rich repeat-containing protein 57	1.77e-06	NA	8.96e-10
3. B	A6NIK2	Leucine-rich repeat-containing protein 10B	5.14e-05	NA	2.47e-07
3. B	Q9BXR5	Toll-like receptor 10	1.32e-02	NA	0.002
3. B	F1MT22	Leucine-rich repeat-containing G-protein coupled receptor 5	3.99e-02	NA	3.53e-05
3. B	Q9LJM4	Receptor-like protein kinase HAIKU2	3.03e-02	NA	0.043
3. B	O64566	Plant intracellular Ras-group-related LRR protein 6	1.42e-04	NA	4.49e-09
3. B	Q8K3W2	Leucine-rich repeat-containing protein 10	5.52e-06	NA	1.16e-12
3. B	P0C895	LRR repeats and ubiquitin-like domain-containing protein At2g30105	1.77e-05	NA	8.99e-09
3. B	Q9XIL9	Pollen-specific leucine-rich repeat extensin-like protein 3	2.27e-02	NA	4.49e-05
3. B	Q9FL28	LRR receptor-like serine/threonine-protein kinase FLS2	1.01e-01	NA	6.73e-04
3. B	Q9R1B9	Slit homolog 2 protein	1.58e-01	NA	0.014
3. B	Q13045	Protein flightless-1 homolog	1.79e-02	NA	1.31e-05
3. B	Q8K3P5	CCR4-NOT transcription complex subunit 6	2.18e-02	NA	1.68e-05
3. B	P51890	Lumican	3.12e-03	NA	3.29e-04
3. B	Q9ERV7	p53-induced death domain-containing protein 1	2.25e-02	NA	2.80e-12
3. B	Q5RFS0	Protein Abitram	9.59e-01	NA	2.39e-17
3. B	D4A1J9	Leucine-rich repeat and fibronectin type-III domain-containing protein 5	1.91e-02	NA	1.64e-04
3. B	Q5BJ41	CCR4-NOT transcription complex subunit 6	1.15e-02	NA	1.70e-05
3. B	P0CP23	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.04e-02	NA	0.002
3. B	Q9H9A6	Leucine-rich repeat-containing protein 40	3.59e-03	NA	3.81e-09
3. B	Q9DBY4	TLR4 interactor with leucine rich repeats	6.75e-02	NA	0.002
3. B	O94294	Leucine-rich repeat-containing protein sog2	1.84e-01	NA	2.49e-05
3. B	Q54M77	Probable serine/threonine-protein kinase roco8	3.51e-01	NA	1.51e-06
3. B	Q6INV3	Leucine-rich repeat-containing protein 57	5.67e-08	NA	2.08e-08
3. B	Q9SZA7	Probable disease resistance protein At4g33300	9.58e-02	NA	0.005
3. B	F4K6B8	Leucine-rich repeat receptor-like serine/threonine-protein kinase RGI4	3.85e-02	NA	0.003
3. B	Q9Y4C4	Malignant fibrous histiocytoma-amplified sequence 1	1.07e-02	NA	1.75e-12
3. B	Q66JT1	Volume-regulated anion channel subunit LRRC8E	2.96e-02	NA	1.20e-06
3. B	Q9ULM6	CCR4-NOT transcription complex subunit 6	4.13e-02	NA	4.07e-04
3. B	Q9LHP4	LRR receptor-like serine/threonine-protein kinase RGI1	6.59e-02	NA	0.021
3. B	Q80X72	Leucine-rich repeat-containing protein 15	3.17e-03	NA	1.60e-04
3. B	Q14160	Protein scribble homolog	1.33e-01	NA	1.73e-07
3. B	Q9V780	Protein lap1	1.02e-02	NA	3.38e-09
3. B	Q7KRY7	Protein lap4	1.43e-01	NA	7.00e-10
3. B	Q01631	Adenylate cyclase	3.31e-01	NA	1.27e-08
3. B	Q6XHA7	Probable serine/threonine-protein kinase roco9	NA	NA	8.83e-11
3. B	Q8RWE5	Plant intracellular Ras-group-related LRR protein 8	2.09e-04	NA	3.19e-09
3. B	P0DO09	Disease resistance protein Piks-1	5.52e-02	NA	2.08e-08
3. B	Q6PGX3	Leucine-rich repeat and fibronectin type III domain-containing protein 1	9.18e-03	NA	0.030
3. B	F7D3V9	Leucine-rich repeat-containing G-protein coupled receptor 5	2.99e-02	NA	0.001
3. B	Q1ENI8	Peroxidasin homolog pxn-1	9.60e-02	NA	0.014
3. B	A6H6A4	Leucine-rich repeat and IQ domain-containing protein 4	6.44e-03	NA	1.42e-09
3. B	Q5BKY1	Leucine-rich repeat-containing protein 10	2.02e-06	NA	2.23e-11
3. B	Q3TX51	Leucine-rich repeat-containing protein 28	5.74e-04	NA	1.03e-06
3. B	Q9ZWC8	Serine/threonine-protein kinase BRI1-like 1	6.78e-02	NA	0.006
3. B	Q1EA11	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	3.08e-02	NA	0.014
3. B	P59383	Leucine-rich repeat neuronal protein 4	1.05e-02	NA	0.012
3. B	Q5RJR8	Leucine-rich repeat-containing protein 59	1.52e-03	NA	0.018
3. B	O88279	Slit homolog 1 protein	4.95e-01	NA	0.015
3. B	P49606	Adenylate cyclase	3.92e-01	NA	6.31e-06
3. B	Q9HBX8	Leucine-rich repeat-containing G-protein coupled receptor 6	7.19e-02	NA	0.003
3. B	O88280	Slit homolog 3 protein	2.45e-01	NA	7.93e-05
3. B	Q3UGP9	Leucine-rich repeat-containing protein 58	5.55e-05	NA	2.76e-10
3. B	Q9WVB4	Slit homolog 3 protein	2.86e-01	NA	4.83e-05
3. B	B4LXW1	Leucine-rich repeat protein soc-2 homolog	6.84e-04	NA	8.39e-13
3. B	Q9Z2H4	Leucine-rich repeat-containing G-protein coupled receptor 4	3.25e-02	NA	8.35e-04
3. B	Q8CHE4	PH domain leucine-rich repeat-containing protein phosphatase 1	2.92e-02	NA	1.17e-10
3. B	Q3ZC49	Leucine-rich repeat-containing protein 39	8.45e-05	NA	2.34e-07
3. B	Q6GLE8	Leucine-rich repeat-containing protein 28	8.75e-06	NA	2.35e-07
3. B	Q6CEJ6	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	8.17e-02	NA	0.002
3. B	Q7KIN0	Toll-like receptor 7	1.79e-01	NA	0.005
3. B	P0DM44	Leucine-rich repeat-containing G-protein coupled receptor 6	3.03e-02	NA	8.89e-04
3. B	Q9VEK6	Leucine-rich repeat protein soc-2 homolog	6.52e-03	NA	9.68e-13
3. B	A7SFP1	Leucine-rich repeat protein soc-2 homolog	8.42e-04	NA	3.30e-09
3. B	Q8VZG8	MDIS1-interacting receptor like kinase 2	5.79e-02	NA	0.002
3. B	Q96CX6	Leucine-rich repeat-containing protein 58	2.29e-04	NA	8.10e-11
3. B	Q96NI6	Leucine-rich repeat and fibronectin type-III domain-containing protein 5	2.53e-02	NA	1.98e-04
3. B	O60346	PH domain leucine-rich repeat-containing protein phosphatase 1	9.02e-02	NA	9.68e-09
3. B	Q05443	Lumican	1.87e-03	NA	0.015
3. B	Q6GV17	Toll-like receptor 10	1.33e-02	NA	0.006
3. B	Q8BXA0	Leucine-rich repeat and fibronectin type-III domain-containing protein 5	3.62e-02	NA	1.65e-04
3. B	Q9C7T7	Receptor protein-tyrosine kinase CEPR2	3.96e-02	NA	0.032
3. B	Q80ZI6	E3 ubiquitin-protein ligase LRSAM1	3.76e-03	NA	8.61e-06
3. B	O65440	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3	2.47e-02	NA	0.041
3. B	Q80U72	Protein scribble homolog	4.47e-02	NA	1.61e-07
3. B	Q8S7M7	Plant intracellular Ras-group-related LRR protein 5	8.50e-04	NA	9.19e-09
3. B	Q9NX38	Protein Abitram	9.56e-01	NA	2.39e-17
3. B	B0M0P8	Ras guanine nucleotide exchange factor L	2.53e-01	NA	2.65e-05
3. B	Q6XHA6	Probable inactive serine/threonine-protein kinase roco10	6.49e-01	NA	0.010
3. B	F2VYU4	Disease resistance protein Pik-1	2.05e-02	NA	2.19e-08
3. B	Q9SJH6	Receptor like protein 29	3.79e-03	NA	1.31e-05
3. B	Q4WQG5	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	6.72e-02	NA	0.034
3. B	D0ZVG2	E3 ubiquitin-protein ligase SspH1	1.66e-02	NA	0.036
3. B	O94813	Slit homolog 2 protein	2.74e-01	NA	0.023
3. B	A2BHJ4	CCR4-NOT transcription complex subunit 6-like	2.61e-02	NA	0.002
3. B	Q7G768	Brassinosteroid LRR receptor kinase BRL2	5.30e-02	NA	2.62e-04
3. B	Q9D1G5	Leucine-rich repeat-containing protein 57	1.53e-06	NA	5.42e-09
3. B	Q8IWT6	Volume-regulated anion channel subunit LRRC8A	5.96e-02	NA	3.39e-08
3. B	Q5RAV5	Leucine-rich repeat protein SHOC-2	4.13e-04	NA	2.42e-11
3. B	Q7L1W4	Volume-regulated anion channel subunit LRRC8D	3.73e-02	NA	4.09e-08
3. B	Q8N456	Leucine-rich repeat-containing protein 18	4.66e-06	NA	1.20e-04
3. B	P82963	Chaoptin (Fragment)	2.13e-02	NA	0.003
3. B	P02750	Leucine-rich alpha-2-glycoprotein	1.12e-03	NA	0.008
3. B	Q9CQ76	Nephrocan	4.53e-04	NA	0.009
3. B	Q9D9Q0	Leucine-rich repeat-containing protein 69	2.73e-04	NA	5.81e-09
3. B	Q9UQ13	Leucine-rich repeat protein SHOC-2	1.24e-03	NA	2.42e-11
3. B	Q80VQ1	Leucine-rich repeat-containing protein 1	6.07e-04	NA	4.37e-09
3. B	Q6P4K6	Serine/threonine-protein kinase 11-interacting protein	4.03e-02	NA	0.025
3. B	Q69JN6	Brassinosteroid LRR receptor kinase BRL1	1.38e-01	NA	0.018
3. B	P51884	Lumican	2.42e-03	NA	0.022
3. B	C0LGK9	Probable LRR receptor-like serine/threonine-protein kinase At2g24230	2.67e-02	NA	2.31e-04
3. B	Q9P244	Leucine-rich repeat and fibronectin type III domain-containing protein 1	6.53e-02	NA	0.003
3. B	V9M398	Disease resistance protein RUN1	1.70e-01	NA	0.004
3. B	Q9DBB9	Carboxypeptidase N subunit 2	1.19e-02	NA	9.61e-07
3. B	Q9VPF0	Protein artichoke	2.24e-01	NA	0.041
3. B	Q6AYI5	Leucine-rich repeat protein SHOC-2	8.91e-03	NA	2.31e-11
3. B	Q9FRS6	Leucine-rich repeat receptor-like protein kinase PXL1	5.51e-02	NA	2.63e-04
3. B	P08678	Adenylate cyclase	4.86e-01	NA	1.58e-06
3. B	Q5E9C0	Ras suppressor protein 1	3.47e-07	NA	1.02e-11
3. B	P34268	Protein flightless-1 homolog	2.54e-02	NA	7.10e-09
3. B	Q80ZQ9	Protein Abitram	9.44e-01	NA	4.36e-14
3. B	F1R6I3	Leucine-rich repeat-containing protein 39	2.24e-04	NA	1.49e-06
3. B	Q9CQ07	Leucine-rich repeat-containing protein 18	5.30e-05	NA	3.58e-05
3. B	Q5ZHW7	Protein Abitram	9.42e-01	NA	6.72e-10
3. B	Q8W4Q3	Plant intracellular Ras-group-related LRR protein 3	6.41e-04	NA	1.78e-10
3. B	Q9ZU46	Receptor protein kinase-like protein ZAR1	1.54e-02	NA	0.042
3. B	Q42484	Disease resistance protein RPS2	5.70e-02	NA	0.015
3. B	Q9SYQ8	Receptor protein kinase CLAVATA1	5.48e-02	NA	0.006
3. B	Q8RZV7	Leucine-rich repeat receptor protein kinase MSP1	1.92e-01	NA	0.005
3. B	Q29S16	Protein Abitram	9.57e-01	NA	9.75e-15
3. B	O61967	Protein lap1	9.35e-04	NA	2.42e-11
3. B	Q7XA42	Putative disease resistance protein RGA1	7.54e-02	NA	7.58e-05
3. B	Q9FK66	Receptor-like protein 55	1.54e-03	NA	2.04e-05
3. B	Q68F79	Volume-regulated anion channel subunit LRRC8E	1.23e-02	NA	8.34e-06
3. B	O70210	Chondroadherin	2.91e-03	NA	7.95e-05
3. B	Q96JM4	Leucine-rich repeat and IQ domain-containing protein 1	3.81e-01	NA	0.033
3. B	B4JTV9	Leucine-rich repeat protein soc-2 homolog	9.21e-04	NA	9.19e-13
3. B	Q28G67	Protein Abitram	9.58e-01	NA	1.50e-09
3. B	Q9SN46	Leucine-rich repeat extensin-like protein 5	8.93e-02	NA	0.029
3. B	Q960C5	Leucine-rich repeat and calponin homology domain-containing protein	2.44e-03	NA	3.39e-06
3. B	Q9JJ28	Protein flightless-1 homolog	3.43e-02	NA	6.81e-04
3. B	Q9FN37	Phytosulfokine receptor 2	3.88e-02	NA	0.021
3. B	G9LZD7	Probable inactive leucine-rich repeat receptor kinase XIAO	3.39e-02	NA	2.83e-05
3. B	B0W6M9	Leucine-rich repeat protein soc-2 homolog	8.10e-04	NA	1.02e-10
3. B	Q2QZF2	Disease resistance protein PIK5-NP	5.56e-02	NA	4.31e-07
3. B	Q9Y2L9	Leucine-rich repeat and calponin homology domain-containing protein 1	1.16e-02	NA	1.13e-09
3. B	Q9LRT1	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040	4.21e-02	NA	8.39e-04
3. B	O75473	Leucine-rich repeat-containing G-protein coupled receptor 5	4.11e-02	NA	7.65e-04
3. B	Q922Q8	Leucine-rich repeat-containing protein 59	1.20e-03	NA	0.015
3. B	P12024	Chaoptin	5.19e-02	NA	0.018
3. B	F4HWL3	Receptor-like protein 4	1.81e-01	NA	0.010
3. B	Q6JN46	Receptor-like protein EIX2	4.29e-02	NA	0.002
3. B	O22476	Protein BRASSINOSTEROID INSENSITIVE 1	1.39e-01	NA	0.003
3. B	O14498	Immunoglobulin superfamily containing leucine-rich repeat protein	4.56e-04	NA	0.009
3. B	D3ZXS4	Leucine-rich repeat-containing protein 39	1.24e-04	NA	1.05e-07
3. B	Q9CRC8	Leucine-rich repeat-containing protein 40	4.12e-03	NA	3.76e-07
3. B	Q9Z1S7	Osteomodulin	1.12e-02	NA	0.010
3. B	P31384	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	7.98e-02	NA	0.001
3. B	A4IIK1	Malignant fibrous histiocytoma-amplified sequence 1 homolog	1.87e-02	NA	1.67e-07
3. B	Q5DU41	Volume-regulated anion channel subunit LRRC8B	2.97e-02	NA	1.20e-09
3. B	O74874	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.31e-02	NA	2.07e-04
3. B	Q8SU52	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	7.46e-03	NA	3.72e-05
3. B	Q9TZM3	Leucine-rich repeat serine/threonine-protein kinase 1	5.34e-01	NA	4.94e-04
3. B	Q54AX5	Leucine-rich repeat protein lrrA	4.00e-04	NA	1.61e-07
3. B	Q7XNY1	Plant intracellular Ras-group-related LRR protein 1	3.45e-04	NA	3.31e-12
3. B	B9F655	Plant intracellular Ras-group-related LRR protein 7	9.18e-06	NA	2.34e-11
3. B	C0LGR3	LRR receptor-like serine/threonine-protein kinase RGI3	4.10e-02	NA	0.013
3. B	Q6ZVD8	PH domain leucine-rich repeat-containing protein phosphatase 2	8.86e-02	NA	1.66e-08
3. B	B3LWU3	Leucine-rich repeat protein soc-2 homolog	2.90e-04	NA	4.32e-12
3. B	Q7XA39	Putative disease resistance protein RGA4	7.60e-02	NA	0.008
3. B	Q1L8Y7	Leucine-rich repeat protein SHOC-2	3.92e-04	NA	6.10e-11
3. B	B4QVR7	Leucine-rich repeat protein soc-2 homolog	2.05e-02	NA	1.03e-12
3. B	Q6P9F7	Volume-regulated anion channel subunit LRRC8B	3.47e-02	NA	6.06e-11
3. B	Q4R3P6	Leucine-rich repeat-containing protein 40	2.01e-03	NA	1.53e-08
3. B	A8WGA3	Leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein	1.60e-02	NA	0.007
3. B	Q5FVI3	Leucine-rich repeat-containing protein 57	2.30e-06	NA	1.11e-09
3. B	Q8GUQ5	Brassinosteroid LRR receptor kinase	1.43e-01	NA	3.09e-06
3. B	Q7F8Q9	Leucine-rich repeat receptor protein kinase MSL1	2.14e-01	NA	1.76e-05
3. B	Q6XHB2	Probable serine/threonine-protein kinase roco4	5.71e-01	NA	0.006
3. B	A6NIV6	Leucine-rich repeat and IQ domain-containing protein 4	5.84e-03	NA	3.39e-13
3. B	O75093	Slit homolog 1 protein	5.46e-01	NA	0.012
3. B	P62046	Leucine-rich repeat and calponin homology domain-containing protein 1	2.95e-03	NA	1.01e-08
3. B	Q498T9	Volume-regulated anion channel subunit LRRC8C	6.91e-03	NA	3.06e-07
3. B	Q8N1G4	Leucine-rich repeat-containing protein 47	6.17e-03	NA	2.40e-05
3. B	Q96DD0	Leucine-rich repeat-containing protein 39	6.33e-05	NA	1.45e-06
3. B	Q80TE7	Leucine-rich repeat-containing protein 7	1.52e-01	NA	4.44e-09
3. B	Q9T0K5	Leucine-rich repeat extensin-like protein 3	2.97e-02	NA	0.009
3. B	Q01513	Adenylate cyclase	2.63e-01	NA	1.20e-08
3. B	Q9S7I6	LRR receptor-like serine/threonine-protein kinase RPK2	7.64e-02	NA	0.002
3. B	Q9ZPS9	Serine/threonine-protein kinase BRI1-like 2	8.80e-02	NA	8.43e-04
3. B	P47735	Receptor-like protein kinase 5	4.99e-02	NA	0.041
3. B	Q80TH2	Erbin	1.12e-01	NA	1.44e-08
3. B	C0LGV1	LRR receptor-like serine/threonine-protein kinase RGI2	4.59e-02	NA	0.011
3. B	Q8C0R9	Leucine-rich repeat and death domain-containing protein 1	8.36e-03	NA	9.24e-12
3. B	A4IFA6	Immunoglobulin superfamily containing leucine-rich repeat protein	5.72e-04	NA	1.44e-04
3. B	Q54WS5	Probable serine/threonine-protein kinase roco6	3.81e-01	NA	1.31e-07
3. B	O77742	Osteomodulin	5.08e-03	NA	0.032
3. B	Q66HD6	Leucine-rich repeat-containing protein 18	6.52e-05	NA	8.82e-05
3. B	Q8BGI7	Leucine-rich repeat-containing protein 39	1.03e-04	NA	2.72e-07
3. B	Q3KRC6	Volume-regulated anion channel subunit LRRC8E	4.03e-02	NA	3.03e-07
3. B	Q7XDQ7	Plant intracellular Ras-group-related LRR protein 8	2.30e-04	NA	1.98e-06
3. B	Q7XBQ9	Disease resistance protein RGA2	1.19e-01	NA	0.009
3. B	Q8MVR1	Cyclic GMP-binding protein C	4.99e-01	NA	1.78e-04
3. B	Q6CJU4	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.11e-02	NA	0.012
3. B	Q921G6	Leucine-rich repeat and calponin homology domain-containing protein 4	1.13e-04	NA	1.52e-09
3. B	O81765	Pollen-specific leucine-rich repeat extensin-like protein 4	1.63e-02	NA	0.002
3. B	Q9C2R2	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.04e-01	NA	0.011
3. B	Q0JA29	LRR receptor-like serine/threonine-protein kinase FLS2	4.30e-02	NA	0.008
3. B	Q4V8I7	Volume-regulated anion channel subunit LRRC8A	1.13e-01	NA	1.03e-08
3. B	E7FE13	Leucine-rich repeat-containing G-protein coupled receptor 4	4.35e-02	NA	4.49e-04
3. B	C0LGJ1	Probable LRR receptor-like serine/threonine-protein kinase At1g74360	7.95e-02	NA	0.010
3. B	Q9FIZ3	LRR receptor-like serine/threonine-protein kinase GSO2	1.11e-01	NA	0.001
3. B	A6QLV3	Leucine-rich repeat protein SHOC-2	5.37e-04	NA	2.42e-11
3. B	C0LGS3	Probable LRR receptor-like serine/threonine-protein kinase At4g37250	2.48e-02	NA	0.034
3. B	A5PK13	Volume-regulated anion channel subunit LRRC8C	6.89e-03	NA	4.02e-08
3. B	Q6AXU9	CCR4-NOT transcription complex subunit 6	2.05e-02	NA	1.68e-05
3. B	Q86X40	Leucine-rich repeat-containing protein 28	2.84e-04	NA	1.03e-04
3. B	C4V7I7	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.70e-03	NA	4.14e-04
3. B	C0LGP9	Probable leucine-rich repeat receptor-like protein kinase IMK3	1.49e-02	NA	0.015
3. B	C0LGQ5	LRR receptor-like serine/threonine-protein kinase GSO1	8.99e-02	NA	1.97e-05
3. B	Q8IW52	SLIT and NTRK-like protein 4	3.51e-02	NA	0.020
3. B	Q0CT27	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.13e-02	NA	0.018
3. B	Q6GU68	Immunoglobulin superfamily containing leucine-rich repeat protein	4.14e-04	NA	4.01e-04
3. B	Q3UVD5	Leucine-rich repeat-containing G-protein coupled receptor 6	2.50e-02	NA	0.010
3. B	O35103	Osteomodulin	3.16e-03	NA	0.043
3. B	Q5U308	Volume-regulated anion channel subunit LRRC8D	3.01e-02	NA	1.09e-08
3. B	Q496Z2	TLR4 interactor with leucine rich repeats	3.56e-02	NA	0.004
3. B	Q1ZXD6	Probable serine/threonine-protein kinase roco5	NA	NA	1.44e-08
3. B	Q8BXA7	PH domain leucine-rich repeat-containing protein phosphatase 2	7.72e-02	NA	1.77e-09
3. B	Q5B778	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.46e-01	NA	0.017
3. B	Q09564	Protein phosphatase PHLPP-like protein	6.75e-02	NA	4.40e-05
3. B	D4AC13	Leucine-rich repeat-containing G-protein coupled receptor 5	4.25e-02	NA	7.65e-04
3. B	A0A290U7C4	Disease resistance protein Roq1	5.94e-02	NA	0.014
3. B	Q6P3Y9	Podocan-like protein 1	5.27e-03	NA	0.005
3. B	A4D1F6	Leucine-rich repeat and death domain-containing protein 1	3.14e-02	NA	2.28e-11
3. B	Q1LU93	Protein Abitram	9.70e-01	NA	2.39e-09
3. B	Q8R502	Volume-regulated anion channel subunit LRRC8C	9.41e-03	NA	2.01e-07
3. B	Q80TR4	Slit homolog 1 protein	3.71e-01	NA	0.011
3. B	P23466	Adenylate cyclase	1.71e-01	NA	6.92e-07
3. B	Q6XHA5	Probable serine/threonine-protein kinase roco11	4.49e-01	NA	0.002
3. B	Q5F4C4	Leucine-rich repeat protein SHOC-2	6.20e-04	NA	5.43e-12
3. B	Q96II8	DISP complex protein LRCH3	5.87e-03	NA	2.19e-09
3. B	Q6ZNQ3	Leucine-rich repeat-containing protein 69	6.80e-05	NA	2.67e-04
3. B	Q54TM7	Probable serine/threonine-protein kinase drkD	3.97e-02	NA	4.29e-07
3. B	Q9M0G7	MDIS1-interacting receptor like kinase 1	5.65e-02	NA	0.022
3. B	Q68CR7	Leucine-rich repeat-containing protein 66	1.13e-02	NA	0.029
3. B	C0LGS2	Probable LRR receptor-like serine/threonine-protein kinase At4g36180	5.32e-02	NA	0.014
3. B	Q9DE67	Lumican	3.25e-03	NA	3.40e-04
3. B	Q6ZH85	Plant intracellular Ras-group-related LRR protein 2	3.84e-04	NA	1.49e-10
3. B	Q8VDB8	Leucine-rich repeat-containing protein 2	2.58e-04	NA	9.50e-08
3. B	Q80WG5	Volume-regulated anion channel subunit LRRC8A	5.93e-02	NA	1.79e-08
3. B	O64973	Disease resistance protein RPS5	1.91e-02	NA	0.008
3. B	Q32KX5	Leucine-rich repeat-containing protein 28	5.16e-05	NA	0.001