Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q6DHL5
(Leucine-rich repeat-containing protein 57) with a FATCAT P-Value: 2.84e-08 and RMSD of 2.22 angstrom. The sequence alignment identity is 13.3%.
Structural alignment shown in left. Query protein Q05C16 colored as red in alignment, homolog Q6DHL5 colored as blue.
Query protein Q05C16 is also shown in right top, homolog Q6DHL5 showed in right bottom. They are colored based on secondary structures.
Q05C16 MQKPPLLLRRPLPPKFTKLSLHEKKTHTAKTGKIESLHVAFTEDETTSIKMDRTRFPDVLRNQSLTPINIQNIFLDHCVQERVTAISSPQKSTKHVREQI 100 Q6DHL5 ---------------------------------------------------------------------------------------------------- 0 Q05C16 PDTATGSIFFPHCNSASTRIFGKQTNKMESSRKFKTMKDVYTEKRLENILILSSKFSKPKSTPGSVIAQKLEKMHPKHQPLPESPGYTYQHISRDLSATV 200 Q6DHL5 ---------------------------------------------------------------------------------------------------- 0 Q05C16 PSPPPMTVSMKPEGQWPEHFKSTATLTLRVTEFPGFVSLPTPVLPRKPHRQSVIETLVTENGNIESVPKQIPPRPPEGLTKTEKIESEIHVVRGEGFKTV 300 Q6DHL5 ---------------------------------------------------------------------------------------------------- 0 Q05C16 AATRYETITAMTNLAIVNCQVYGRNALNLKGFFILNCPDLTPLAFQLIYLNLSFNDLHYFPTEILCL-KNLQILKLRNNPIKEIPSEIQQLEFLRIFTIA 399 Q6DHL5 ---------------------MGNSA--LKAH--LETSQKTGV-FQLTGKGLT--E---FPEDLQKLTANLRTVDLSNNKIEELPAFIGSFQHLKSFTIS 69 Q05C16 FNLITVLP--IGLFSLSYLEELDVSYNELTFIPNEIQKLRSLEKLTVDGNELSFFPHGI--LK----LNLTKIQFENNFTHPCFWRDNYLNNPQQLTQI- 490 Q6DHL5 CNKLTSLPNDIG--KLKKLETLILNGNQLKQLPSSIGQLKSLRTLSLSGNQFKEFPSGLGTLRQLDVLDLSK----NQI------R--VV--PAEVAELQ 153 Q05C16 -ISLFIVQNKLHKF---YDKIPVEVQKLLKWGAQFLTELA--PLSIYS-SRKAI--TEGYIAVELPKFEESKNITEGLLTQKRYEEVMVKCINATTVTS- 580 Q6DHL5 AIEINLNQNQISSVTQEVSRTP-RL-KVLRLEENCL-ELSSIPLSILTDSQVSLLSVEGNL-FEVKKMRD----LEG------YDKYMER----FTATKK 235 Q05C16 --- 580 Q6DHL5 KFA 238
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0030199 | collagen fibril organization |
| 1. PB | GO:0060348 | bone development |
| 1. PB | GO:0055046 | microgametogenesis |
| 1. PB | GO:0031012 | extracellular matrix |
| 1. PB | GO:0008201 | heparin binding |
| 1. PB | GO:0005518 | collagen binding |
| 2. P | GO:0030198 | extracellular matrix organization |
| 2. P | GO:0043014 | alpha-tubulin binding |
| 2. P | GO:0140278 | mitotic division septum assembly |
| 2. P | GO:0035591 | signaling adaptor activity |
| 2. P | GO:0051293 | establishment of spindle localization |
| 2. P | GO:0045132 | meiotic chromosome segregation |
| 2. P | GO:0007160 | cell-matrix adhesion |
| 2. P | GO:0007565 | female pregnancy |
| 2. P | GO:0009416 | response to light stimulus |
| 2. P | GO:0043153 | entrainment of circadian clock by photoperiod |
| 2. P | GO:0030953 | astral microtubule organization |
| 2. P | GO:0014033 | neural crest cell differentiation |
| 2. P | GO:0006515 | protein quality control for misfolded or incompletely synthesized proteins |
| 2. P | GO:0005201 | extracellular matrix structural constituent |
| 2. P | GO:0070052 | collagen V binding |
| 2. P | GO:0031028 | septation initiation signaling |
| 2. P | GO:0007399 | nervous system development |
| 2. P | GO:0019005 | SCF ubiquitin ligase complex |
| 2. P | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 2. P | GO:0008589 | regulation of smoothened signaling pathway |
| 2. P | GO:0061975 | articular cartilage development |
| 2. P | GO:0000073 | initial mitotic spindle pole body separation |
| 2. P | GO:0000209 | protein polyubiquitination |
| 2. P | GO:0016567 | protein ubiquitination |
| 2. P | GO:0045597 | positive regulation of cell differentiation |
| 2. P | GO:0007605 | sensory perception of sound |
| 2. P | GO:0000086 | G2/M transition of mitotic cell cycle |
| 2. P | GO:0005178 | integrin binding |
| 2. P | GO:0016525 | negative regulation of angiogenesis |
| 2. P | GO:0005576 | extracellular region |
| 2. P | GO:0009555 | pollen development |
| 2. P | GO:0031146 | SCF-dependent proteasomal ubiquitin-dependent protein catabolic process |
| 2. P | GO:0031536 | positive regulation of exit from mitosis |
| 2. P | GO:0051726 | regulation of cell cycle |
| 2. P | GO:0010811 | positive regulation of cell-substrate adhesion |
| 2. P | GO:0005539 | glycosaminoglycan binding |
| 2. P | GO:0061499 | outer plaque of mitotic spindle pole body |
| 2. P | GO:0045504 | dynein heavy chain binding |
| 2. P | GO:1902412 | regulation of mitotic cytokinesis |
| 2. P | GO:0044732 | mitotic spindle pole body |
| 2. P | GO:0005614 | interstitial matrix |
| 3. B | GO:0010449 | root meristem growth |
| 3. B | GO:0030014 | CCR4-NOT complex |
| 3. B | GO:0042277 | peptide binding |
| 3. B | GO:0009729 | detection of brassinosteroid stimulus |
| 3. B | GO:0016080 | synaptic vesicle targeting |
| 3. B | GO:0030837 | negative regulation of actin filament polymerization |
| 3. B | GO:0046007 | negative regulation of activated T cell proliferation |
| 3. B | GO:0070848 | response to growth factor |
| 3. B | GO:0045571 | negative regulation of imaginal disc growth |
| 3. B | GO:0090037 | positive regulation of protein kinase C signaling |
| 3. B | GO:2001013 | epithelial cell proliferation involved in renal tubule morphogenesis |
| 3. B | GO:0006368 | transcription elongation from RNA polymerase II promoter |
| 3. B | GO:0007089 | traversing start control point of mitotic cell cycle |
| 3. B | GO:0002237 | response to molecule of bacterial origin |
| 3. B | GO:0002718 | regulation of cytokine production involved in immune response |
| 3. B | GO:0099147 | extrinsic component of postsynaptic density membrane |
| 3. B | GO:0006884 | cell volume homeostasis |
| 3. B | GO:0043615 | astrocyte cell migration |
| 3. B | GO:0045186 | zonula adherens assembly |
| 3. B | GO:0061161 | positive regulation of establishment of bipolar cell polarity regulating cell shape |
| 3. B | GO:0005095 | GTPase inhibitor activity |
| 3. B | GO:0036360 | sorocarp stalk morphogenesis |
| 3. B | GO:0030539 | male genitalia development |
| 3. B | GO:0048281 | inflorescence morphogenesis |
| 3. B | GO:0010069 | zygote asymmetric cytokinesis in embryo sac |
| 3. B | GO:0060412 | ventricular septum morphogenesis |
| 3. B | GO:0015734 | taurine transport |
| 3. B | GO:0071470 | cellular response to osmotic stress |
| 3. B | GO:0090406 | pollen tube |
| 3. B | GO:0030426 | growth cone |
| 3. B | GO:0045663 | positive regulation of myoblast differentiation |
| 3. B | GO:1904417 | positive regulation of xenophagy |
| 3. B | GO:0071672 | negative regulation of smooth muscle cell chemotaxis |
| 3. B | GO:0019903 | protein phosphatase binding |
| 3. B | GO:0106310 | protein serine kinase activity |
| 3. B | GO:0010103 | stomatal complex morphogenesis |
| 3. B | GO:0016500 | protein-hormone receptor activity |
| 3. B | GO:0048495 | Roundabout binding |
| 3. B | GO:0008330 | protein tyrosine/threonine phosphatase activity |
| 3. B | GO:0005615 | extracellular space |
| 3. B | GO:0043116 | negative regulation of vascular permeability |
| 3. B | GO:0007163 | establishment or maintenance of cell polarity |
| 3. B | GO:0071221 | cellular response to bacterial lipopeptide |
| 3. B | GO:0099061 | integral component of postsynaptic density membrane |
| 3. B | GO:0004722 | protein serine/threonine phosphatase activity |
| 3. B | GO:0060581 | cell fate commitment involved in pattern specification |
| 3. B | GO:0006954 | inflammatory response |
| 3. B | GO:0072282 | metanephric nephron tubule morphogenesis |
| 3. B | GO:0051489 | regulation of filopodium assembly |
| 3. B | GO:0106307 | |
| 3. B | GO:0030054 | cell junction |
| 3. B | GO:0048508 | embryonic meristem development |
| 3. B | GO:0030587 | sorocarp development |
| 3. B | GO:0015698 | inorganic anion transport |
| 3. B | GO:0001657 | ureteric bud development |
| 3. B | GO:0002667 | regulation of T cell anergy |
| 3. B | GO:0032433 | filopodium tip |
| 3. B | GO:0000288 | nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay |
| 3. B | GO:0045930 | negative regulation of mitotic cell cycle |
| 3. B | GO:0007283 | spermatogenesis |
| 3. B | GO:0002329 | pre-B cell differentiation |
| 3. B | GO:0098887 | neurotransmitter receptor transport, endosome to postsynaptic membrane |
| 3. B | GO:2000786 | positive regulation of autophagosome assembly |
| 3. B | GO:0000076 | DNA replication checkpoint signaling |
| 3. B | GO:0043231 | intracellular membrane-bounded organelle |
| 3. B | GO:0002764 | immune response-regulating signaling pathway |
| 3. B | GO:0010606 | positive regulation of cytoplasmic mRNA processing body assembly |
| 3. B | GO:0045108 | regulation of intermediate filament polymerization or depolymerization |
| 3. B | GO:0070100 | negative regulation of chemokine-mediated signaling pathway |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:0001768 | establishment of T cell polarity |
| 3. B | GO:1905606 | regulation of presynapse assembly |
| 3. B | GO:0070966 | nuclear-transcribed mRNA catabolic process, no-go decay |
| 3. B | GO:0006970 | response to osmotic stress |
| 3. B | GO:0030714 | anterior/posterior axis specification, follicular epithelium |
| 3. B | GO:0140360 | cyclic-GMP-AMP transmembrane transporter activity |
| 3. B | GO:0032588 | trans-Golgi network membrane |
| 3. B | GO:0019199 | transmembrane receptor protein kinase activity |
| 3. B | GO:0070086 | ubiquitin-dependent endocytosis |
| 3. B | GO:0010596 | negative regulation of endothelial cell migration |
| 3. B | GO:0016336 | establishment or maintenance of polarity of larval imaginal disc epithelium |
| 3. B | GO:0050929 | induction of negative chemotaxis |
| 3. B | GO:0030282 | bone mineralization |
| 3. B | GO:0016332 | establishment or maintenance of polarity of embryonic epithelium |
| 3. B | GO:0005176 | ErbB-2 class receptor binding |
| 3. B | GO:0048839 | inner ear development |
| 3. B | GO:0090548 | response to nitrate starvation |
| 3. B | GO:0010233 | phloem transport |
| 3. B | GO:0034142 | toll-like receptor 4 signaling pathway |
| 3. B | GO:2000280 | regulation of root development |
| 3. B | GO:0008045 | motor neuron axon guidance |
| 3. B | GO:0034750 | Scrib-APC-beta-catenin complex |
| 3. B | GO:0099560 | synaptic membrane adhesion |
| 3. B | GO:1902476 | chloride transmembrane transport |
| 3. B | GO:0007601 | visual perception |
| 3. B | GO:0030239 | myofibril assembly |
| 3. B | GO:0042659 | regulation of cell fate specification |
| 3. B | GO:1905103 | integral component of lysosomal membrane |
| 3. B | GO:0005887 | integral component of plasma membrane |
| 3. B | GO:0021972 | corticospinal neuron axon guidance through spinal cord |
| 3. B | GO:0009742 | brassinosteroid mediated signaling pathway |
| 3. B | GO:0003181 | atrioventricular valve morphogenesis |
| 3. B | GO:0031589 | cell-substrate adhesion |
| 3. B | GO:0045175 | basal protein localization |
| 3. B | GO:0030056 | hemidesmosome |
| 3. B | GO:0090038 | negative regulation of protein kinase C signaling |
| 3. B | GO:0071676 | negative regulation of mononuclear cell migration |
| 3. B | GO:0098968 | neurotransmitter receptor transport postsynaptic membrane to endosome |
| 3. B | GO:0033563 | dorsal/ventral axon guidance |
| 3. B | GO:0002224 | toll-like receptor signaling pathway |
| 3. B | GO:0002689 | negative regulation of leukocyte chemotaxis |
| 3. B | GO:0017017 | MAP kinase tyrosine/serine/threonine phosphatase activity |
| 3. B | GO:0004532 | exoribonuclease activity |
| 3. B | GO:0051014 | actin filament severing |
| 3. B | GO:0034130 | toll-like receptor 1 signaling pathway |
| 3. B | GO:0035385 | Roundabout signaling pathway |
| 3. B | GO:0060561 | apoptotic process involved in morphogenesis |
| 3. B | GO:0044291 | cell-cell contact zone |
| 3. B | GO:0005789 | endoplasmic reticulum membrane |
| 3. B | GO:0072202 | cell differentiation involved in metanephros development |
| 3. B | GO:0006952 | defense response |
| 3. B | GO:0008157 | protein phosphatase 1 binding |
| 3. B | GO:0099139 | cheating during chimeric sorocarp development |
| 3. B | GO:0002758 | innate immune response-activating signal transduction |
| 3. B | GO:0006171 | cAMP biosynthetic process |
| 3. B | GO:0005199 | structural constituent of cell wall |
| 3. B | GO:0051015 | actin filament binding |
| 3. B | GO:0003184 | pulmonary valve morphogenesis |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0043531 | ADP binding |
| 3. B | GO:0010067 | procambium histogenesis |
| 3. B | GO:0008528 | G protein-coupled peptide receptor activity |
| 3. B | GO:0043030 | regulation of macrophage activation |
| 3. B | GO:0010148 | transpiration |
| 3. B | GO:0010359 | regulation of anion channel activity |
| 3. B | GO:0048812 | neuron projection morphogenesis |
| 3. B | GO:0021510 | spinal cord development |
| 3. B | GO:0000188 | obsolete inactivation of MAPK activity |
| 3. B | GO:0009649 | entrainment of circadian clock |
| 3. B | GO:0005583 | fibrillar collagen trimer |
| 3. B | GO:0021836 | chemorepulsion involved in postnatal olfactory bulb interneuron migration |
| 3. B | GO:0010183 | pollen tube guidance |
| 3. B | GO:0060088 | auditory receptor cell stereocilium organization |
| 3. B | GO:0035354 | Toll-like receptor 1-Toll-like receptor 2 protein complex |
| 3. B | GO:0051393 | alpha-actinin binding |
| 3. B | GO:0010078 | maintenance of root meristem identity |
| 3. B | GO:0043928 | exonucleolytic catabolism of deadenylated mRNA |
| 3. B | GO:1903077 | negative regulation of protein localization to plasma membrane |
| 3. B | GO:0061290 | canonical Wnt signaling pathway involved in metanephric kidney development |
| 3. B | GO:0060763 | mammary duct terminal end bud growth |
| 3. B | GO:0032495 | response to muramyl dipeptide |
| 3. B | GO:0106311 | |
| 3. B | GO:0098609 | cell-cell adhesion |
| 3. B | GO:0014069 | postsynaptic density |
| 3. B | GO:0050673 | epithelial cell proliferation |
| 3. B | GO:0033612 | receptor serine/threonine kinase binding |
| 3. B | GO:0001818 | negative regulation of cytokine production |
| 3. B | GO:0016607 | nuclear speck |
| 3. B | GO:0014912 | negative regulation of smooth muscle cell migration |
| 3. B | GO:0005496 | steroid binding |
| 3. B | GO:0016045 | detection of bacterium |
| 3. B | GO:0106306 | |
| 3. B | GO:0036335 | intestinal stem cell homeostasis |
| 3. B | GO:0034137 | positive regulation of toll-like receptor 2 signaling pathway |
| 3. B | GO:0043327 | chemotaxis to cAMP |
| 3. B | GO:0035970 | peptidyl-threonine dephosphorylation |
| 3. B | GO:0030017 | sarcomere |
| 3. B | GO:0051414 | response to cortisol |
| 3. B | GO:0007318 | pole plasm protein localization |
| 3. B | GO:0030374 | nuclear receptor coactivator activity |
| 3. B | GO:0090288 | negative regulation of cellular response to growth factor stimulus |
| 3. B | GO:0032922 | circadian regulation of gene expression |
| 3. B | GO:0035089 | establishment of apical/basal cell polarity |
| 3. B | GO:0031290 | retinal ganglion cell axon guidance |
| 3. B | GO:0032968 | positive regulation of transcription elongation from RNA polymerase II promoter |
| 3. B | GO:0140361 | cyclic-GMP-AMP transmembrane import across plasma membrane |
| 3. B | GO:0051898 | negative regulation of protein kinase B signaling |
| 3. B | GO:1900140 | regulation of seedling development |
| 3. B | GO:0032914 | positive regulation of transforming growth factor beta1 production |
| 3. B | GO:0016333 | morphogenesis of follicular epithelium |
| 3. B | GO:0034123 | positive regulation of toll-like receptor signaling pathway |
| 3. B | GO:0007265 | Ras protein signal transduction |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0060603 | mammary gland duct morphogenesis |
| 3. B | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 3. B | GO:0051058 | negative regulation of small GTPase mediated signal transduction |
| 3. B | GO:0030517 | negative regulation of axon extension |
| 3. B | GO:1900744 | regulation of p38MAPK cascade |
| 3. B | GO:0071504 | cellular response to heparin |
| 3. B | GO:0043237 | laminin-1 binding |
| 3. B | GO:0022028 | tangential migration from the subventricular zone to the olfactory bulb |
| 3. B | GO:0031430 | M band |
| 3. B | GO:0001737 | establishment of imaginal disc-derived wing hair orientation |
| 3. B | GO:0035308 | negative regulation of protein dephosphorylation |
| 3. B | GO:0061809 | NAD+ nucleotidase, cyclic ADP-ribose generating |
| 3. B | GO:0007190 | activation of adenylate cyclase activity |
| 3. B | GO:0090260 | negative regulation of retinal ganglion cell axon guidance |
| 3. B | GO:0043194 | axon initial segment |
| 3. B | GO:0046849 | bone remodeling |
| 3. B | GO:0071896 | protein localization to adherens junction |
| 3. B | GO:0009986 | cell surface |
| 3. B | GO:0001942 | hair follicle development |
| 3. B | GO:0030859 | polarized epithelial cell differentiation |
| 3. B | GO:0007165 | signal transduction |
| 3. B | GO:0048846 | axon extension involved in axon guidance |
| 3. B | GO:0034702 | ion channel complex |
| 3. B | GO:0051270 | regulation of cellular component movement |
| 3. B | GO:0007097 | nuclear migration |
| 3. B | GO:0072002 | Malpighian tubule development |
| 3. B | GO:0048843 | negative regulation of axon extension involved in axon guidance |
| 3. B | GO:0050919 | negative chemotaxis |
| 3. B | GO:0034144 | negative regulation of toll-like receptor 4 signaling pathway |
| 3. B | GO:0098978 | glutamatergic synapse |
| 3. B | GO:0048226 | Casparian strip |
| 3. B | GO:0055013 | cardiac muscle cell development |
| 3. B | GO:0009626 | plant-type hypersensitive response |
| 3. B | GO:0042495 | detection of triacyl bacterial lipopeptide |
| 3. B | GO:0060866 | leaf abscission |
| 3. B | GO:0016020 | membrane |
| 3. B | GO:0007527 | adult somatic muscle development |
| 3. B | GO:0006977 | DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest |
| 3. B | GO:0016323 | basolateral plasma membrane |
| 3. B | GO:0009942 | longitudinal axis specification |
| 3. B | GO:0097120 | receptor localization to synapse |
| 3. B | GO:0046813 | receptor-mediated virion attachment to host cell |
| 3. B | GO:0043031 | negative regulation of macrophage activation |
| 3. B | GO:1990523 | bone regeneration |
| 3. B | GO:0004535 | poly(A)-specific ribonuclease activity |
| 3. B | GO:0030308 | negative regulation of cell growth |
| 3. B | GO:0010004 | gastrulation involving germ band extension |
| 3. B | GO:0070433 | negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway |
| 3. B | GO:0004674 | protein serine/threonine kinase activity |
| 3. B | GO:0043394 | proteoglycan binding |
| 3. B | GO:0048657 | anther wall tapetum cell differentiation |
| 3. B | GO:2000405 | negative regulation of T cell migration |
| 3. B | GO:0002042 | cell migration involved in sprouting angiogenesis |
| 3. B | GO:0021772 | olfactory bulb development |
| 3. B | GO:0042622 | photoreceptor outer segment membrane |
| 3. B | GO:0021747 | cochlear nucleus development |
| 3. B | GO:1990869 | cellular response to chemokine |
| 3. B | GO:0009755 | hormone-mediated signaling pathway |
| 3. B | GO:0006470 | protein dephosphorylation |
| 3. B | GO:0048813 | dendrite morphogenesis |
| 3. B | GO:0000932 | P-body |
| 3. B | GO:0001649 | osteoblast differentiation |
| 3. B | GO:0048565 | digestive tract development |
| 3. B | GO:0045087 | innate immune response |
| 3. B | GO:0035335 | peptidyl-tyrosine dephosphorylation |
| 3. B | GO:0016334 | establishment or maintenance of polarity of follicular epithelium |
| 3. B | GO:0051897 | positive regulation of protein kinase B signaling |
| 3. B | GO:0120163 | negative regulation of cold-induced thermogenesis |
| 3. B | GO:0071638 | negative regulation of monocyte chemotactic protein-1 production |
| 3. B | GO:1900181 | negative regulation of protein localization to nucleus |
| 3. B | GO:0031047 | gene silencing by RNA |
| 3. B | GO:0032870 | cellular response to hormone stimulus |
| 3. B | GO:0034166 | toll-like receptor 10 signaling pathway |
| 3. B | GO:0046755 | viral budding |
| 3. B | GO:0030015 | CCR4-NOT core complex |
| 3. B | GO:0005912 | adherens junction |
| 3. B | GO:0099072 | regulation of postsynaptic membrane neurotransmitter receptor levels |
| 3. B | GO:0008625 | extrinsic apoptotic signaling pathway via death domain receptors |
| 3. B | GO:0004675 | transmembrane receptor protein serine/threonine kinase activity |
| 3. B | GO:0031150 | sorocarp stalk development |
| 3. B | GO:0003180 | aortic valve morphogenesis |
| 3. B | GO:0015810 | aspartate transmembrane transport |
| 3. B | GO:0008154 | actin polymerization or depolymerization |
| 3. B | GO:0007411 | axon guidance |
| 3. B | GO:0051964 | negative regulation of synapse assembly |
| 3. B | GO:0035748 | myelin sheath abaxonal region |
| 3. B | GO:0034122 | negative regulation of toll-like receptor signaling pathway |
| 3. B | GO:0030500 | regulation of bone mineralization |
| 3. B | GO:0050918 | positive chemotaxis |
| 3. B | GO:0016791 | phosphatase activity |
| 3. B | GO:1900155 | negative regulation of bone trabecula formation |
| 3. B | GO:0010087 | phloem or xylem histogenesis |
| 3. B | GO:0021888 | hypothalamus gonadotrophin-releasing hormone neuron development |
| 3. B | GO:0005225 | volume-sensitive anion channel activity |
| 3. B | GO:0001678 | cellular glucose homeostasis |
| 3. B | GO:0043236 | laminin binding |
| 3. B | GO:0038187 | pattern recognition receptor activity |
| 3. B | GO:0045806 | negative regulation of endocytosis |
| 3. B | GO:0090696 | post-embryonic plant organ development |
| 3. B | GO:0036289 | peptidyl-serine autophosphorylation |
| 3. B | GO:0000175 | 3'-5'-exoribonuclease activity |
| 3. B | GO:0062200 | RAM/MOR signaling pathway |
| 3. B | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:0004016 | adenylate cyclase activity |
| 3. B | GO:0016335 | morphogenesis of larval imaginal disc epithelium |
| 3. B | GO:0050728 | negative regulation of inflammatory response |
| 3. B | GO:0048478 | replication fork protection |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:0043065 | positive regulation of apoptotic process |
| 3. B | GO:0035996 | rhabdomere microvillus |
| 3. B | GO:0032185 | septin cytoskeleton organization |
| 3. B | GO:0000287 | magnesium ion binding |
| 3. B | GO:0061364 | apoptotic process involved in luteolysis |
| 3. B | GO:0034136 | negative regulation of toll-like receptor 2 signaling pathway |
| 3. B | GO:0045444 | fat cell differentiation |
| 3. B | GO:0009945 | radial axis specification |
| 3. B | GO:0090190 | positive regulation of branching involved in ureteric bud morphogenesis |
| 3. B | GO:2000067 | regulation of root morphogenesis |
| 3. B | GO:0036342 | post-anal tail morphogenesis |
| 3. B | GO:0050135 | NAD(P)+ nucleosidase activity |
| 3. B | GO:0035663 | Toll-like receptor 2 binding |
| 3. B | GO:0043408 | regulation of MAPK cascade |
| 3. B | GO:0043122 | regulation of I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0010619 | adenylate cyclase-activating glucose-activated G protein-coupled receptor signaling pathway |
| 3. B | GO:0004721 | phosphoprotein phosphatase activity |
| 3. B | GO:0001530 | lipopolysaccharide binding |
| 3. B | GO:0043395 | heparan sulfate proteoglycan binding |
| 3. B | GO:0090024 | negative regulation of neutrophil chemotaxis |
| 3. B | GO:0072224 | metanephric glomerulus development |
| 3. B | GO:0051019 | mitogen-activated protein kinase binding |
| 3. B | GO:0001921 | positive regulation of receptor recycling |
| 3. B | GO:0046328 | regulation of JNK cascade |
| 3. B | GO:1905421 | regulation of plant organ morphogenesis |
| 3. B | GO:0009994 | oocyte differentiation |
| 3. B | GO:0016593 | Cdc73/Paf1 complex |
| 3. B | GO:0010593 | negative regulation of lamellipodium assembly |
| 3. B | GO:0048884 | neuromast development |
| 3. B | GO:0099149 | regulation of postsynaptic neurotransmitter receptor internalization |
| 3. B | GO:0035580 | specific granule lumen |
| 3. B | GO:0090708 | specification of plant organ axis polarity |
| 3. B | GO:0043113 | receptor clustering |
| 3. B | GO:0000289 | nuclear-transcribed mRNA poly(A) tail shortening |
| 3. B | GO:0034214 | protein hexamerization |
| 3. B | GO:0098656 | anion transmembrane transport |
| 3. B | GO:0010070 | zygote asymmetric cell division |
| 3. B | GO:0046696 | lipopolysaccharide receptor complex |
| 3. B | GO:0010082 | regulation of root meristem growth |
| 3. B | GO:0030833 | regulation of actin filament polymerization |
| 3. B | GO:0002093 | auditory receptor cell morphogenesis |
| 3. B | GO:0090027 | negative regulation of monocyte chemotaxis |
| 3. B | GO:0016331 | morphogenesis of embryonic epithelium |
| 3. B | GO:0042067 | establishment of ommatidial planar polarity |
| 3. B | GO:0046579 | positive regulation of Ras protein signal transduction |
| 3. B | GO:0001653 | peptide receptor activity |
| 3. B | GO:0002755 | MyD88-dependent toll-like receptor signaling pathway |
| 3. B | GO:0051302 | regulation of cell division |
| 3. B | GO:0045499 | chemorepellent activity |
| 3. B | GO:0006820 | anion transport |
| 3. B | GO:0051016 | barbed-end actin filament capping |
| 3. B | GO:0048754 | branching morphogenesis of an epithelial tube |
| 3. B | GO:0099151 | regulation of postsynaptic density assembly |
| 3. B | GO:1903224 | regulation of endodermal cell differentiation |
| 3. B | GO:0003779 | actin binding |
| 3. B | GO:0062023 | collagen-containing extracellular matrix |
| 3. B | GO:0004888 | transmembrane signaling receptor activity |
| 3. B | GO:0005546 | phosphatidylinositol-4,5-bisphosphate binding |
| 3. B | GO:0042645 | mitochondrial nucleoid |
| 3. B | GO:0001656 | metanephros development |
| 3. B | GO:0007189 | adenylate cyclase-activating G protein-coupled receptor signaling pathway |
| 3. B | GO:0032024 | positive regulation of insulin secretion |
| 3. B | GO:0000164 | protein phosphatase type 1 complex |
| 3. B | GO:0022029 | telencephalon cell migration |
| 3. B | GO:0010074 | maintenance of meristem identity |
| 3. B | GO:0035239 | tube morphogenesis |
| 3. B | GO:0034163 | regulation of toll-like receptor 9 signaling pathway |
| 3. B | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0003785 | actin monomer binding |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q9SVW8 | Plant intracellular Ras-group-related LRR protein 4 | 2.63e-03 | 1.73e-03 | 2.89e-08 |
| 1. PB | Q9FFJ3 | Plant intracellular Ras-group-related LRR protein 1 | 1.46e-03 | 1.20e-06 | 8.20e-08 |
| 1. PB | Q8VYG9 | Plant intracellular Ras-group-related LRR protein 9 | 1.23e-03 | 4.27e-05 | 4.19e-11 |
| 1. PB | Q6Z8P4 | Plant intracellular Ras-group-related LRR protein 4 | 4.16e-04 | 2.43e-03 | 1.96e-09 |
| 1. PB | Q5G5E0 | Plant intracellular Ras-group-related LRR protein 5 | 5.13e-04 | 9.50e-03 | 1.45e-08 |
| 1. PB | A6H694 | Leucine-rich repeat-containing protein 63 | 1.51e-05 | 1.44e-33 | 7.94e-140 |
| 1. PB | Q96L50 | Leucine-rich repeat protein 1 | 3.42e-04 | 4.60e-03 | 8.59e-05 |
| 1. PB | Q05C16 | Leucine-rich repeat-containing protein 63 | 0 | 7.73e-143 | 0.0 |
| 1. PB | Q4V8G0 | Leucine-rich repeat-containing protein 63 | 5.92e-04 | 4.97e-39 | 3.18e-138 |
| 2. P | Q5FW85 | Extracellular matrix protein 2 | 2.84e-02 | 4.62e-05 | NA |
| 2. P | Q3MHH9 | Extracellular matrix protein 2 | 3.50e-03 | 8.25e-04 | NA |
| 2. P | P32336 | Protein NUD1 | 2.67e-02 | 4.56e-10 | NA |
| 2. P | Q9UF56 | F-box/LRR-repeat protein 17 | 1.94e-02 | 4.04e-02 | NA |
| 2. P | Q99645 | Epiphycan | 3.09e-03 | 1.71e-02 | NA |
| 2. P | G5EDE9 | ANK repeat-containing protein nipk-1 | 2.21e-01 | 2.30e-02 | NA |
| 2. P | P83286 | Opticin | 3.34e-03 | 1.93e-02 | NA |
| 2. P | Q90944 | Epiphycan | 4.50e-03 | 9.92e-04 | NA |
| 2. P | P70186 | Epiphycan | 2.30e-03 | 2.18e-02 | NA |
| 2. P | Q9QZN1 | F-box/LRR-repeat protein 17 | 3.69e-02 | 3.24e-02 | NA |
| 2. P | Q96QE4 | Leucine-rich repeat-containing protein 37B | 8.54e-03 | 1.29e-07 | NA |
| 2. P | O94769 | Extracellular matrix protein 2 | 2.72e-02 | 1.01e-05 | NA |
| 2. P | Q920A0 | Opticin | 1.05e-03 | 3.68e-03 | NA |
| 2. P | O74473 | Septation initiation network scaffold protein cdc11 | 3.79e-02 | 4.02e-09 | NA |
| 2. P | Q9UBM4 | Opticin | 4.77e-03 | 1.64e-03 | NA |
| 3. B | A4IHG1 | Leucine-rich repeat-containing protein 58 | 3.88e-04 | NA | 1.45e-07 |
| 3. B | Q54XZ5 | Probable serine/threonine-protein kinase DDB_G0278509 | 2.21e-02 | NA | 1.58e-04 |
| 3. B | F4JTU7 | Receptor-like protein 48 | 6.87e-02 | NA | 0.024 |
| 3. B | Q9FII5 | Leucine-rich repeat receptor-like protein kinase TDR | 3.84e-02 | NA | 0.031 |
| 3. B | P0CP22 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 2.56e-02 | NA | 0.002 |
| 3. B | O46379 | Lumican (Fragment) | 1.74e-06 | NA | 0.005 |
| 3. B | Q8VEG6 | CCR4-NOT transcription complex subunit 6-like | 1.78e-02 | NA | 0.026 |
| 3. B | O75094 | Slit homolog 3 protein | 1.48e-01 | NA | 2.15e-05 |
| 3. B | Q75BI3 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 7.01e-02 | NA | 0.017 |
| 3. B | Q32NT4 | Leucine-rich repeat-containing protein 58 | 2.91e-04 | NA | 8.37e-09 |
| 3. B | Q9BYS8 | Leucine-rich repeat-containing protein 2 | 2.05e-04 | NA | 1.14e-08 |
| 3. B | Q24020 | Protein flightless-1 | 3.65e-02 | NA | 1.94e-06 |
| 3. B | Q8AVI4 | Leucine-rich repeat protein SHOC-2 | 6.42e-03 | NA | 8.94e-11 |
| 3. B | B4IBI9 | Leucine-rich repeat protein soc-2 homolog | 2.69e-02 | NA | 1.01e-12 |
| 3. B | Q6GR35 | Protein Abitram | 9.65e-01 | NA | 1.50e-10 |
| 3. B | Q9VJ07 | Protein phosphatase PHLPP-like protein | 9.48e-02 | NA | 4.71e-04 |
| 3. B | Q2UUI3 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 3.87e-02 | NA | 0.003 |
| 3. B | Q5RFE9 | Leucine-rich repeat-containing protein 40 | 2.97e-03 | NA | 9.72e-09 |
| 3. B | Q7XK44 | Plant intracellular Ras-group-related LRR protein 3 | 1.32e-04 | NA | 5.20e-08 |
| 3. B | Q5E9X4 | Leucine-rich repeat-containing protein 59 | 1.16e-03 | NA | 0.007 |
| 3. B | B5UBC1 | Disease resistance protein Pikm1-TS | 5.50e-02 | NA | 2.19e-08 |
| 3. B | Q9LRV8 | Plant intracellular Ras-group-related LRR protein 2 | 2.06e-04 | NA | 1.14e-14 |
| 3. B | O75427 | Leucine-rich repeat and calponin homology domain-containing protein 4 | 8.32e-04 | NA | 5.97e-09 |
| 3. B | Q5VUJ6 | Leucine-rich repeat and calponin homology domain-containing protein 2 | 8.71e-04 | NA | 1.96e-09 |
| 3. B | P51885 | Lumican | 4.30e-03 | NA | 0.022 |
| 3. B | Q7SXW3 | Leucine-rich repeat-containing protein 40 | 1.79e-03 | NA | 1.04e-09 |
| 3. B | O93233 | Phospholipase A2 inhibitor | 1.36e-03 | NA | 0.001 |
| 3. B | Q96RT1 | Erbin | 9.02e-02 | NA | 9.42e-09 |
| 3. B | Q5G5D8 | Plant intracellular Ras-group-related LRR protein 7 | 2.64e-04 | NA | 2.03e-07 |
| 3. B | Q8L899 | Systemin receptor SR160 | 1.37e-01 | NA | 1.30e-05 |
| 3. B | Q6FRT2 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.13e-02 | NA | 1.19e-04 |
| 3. B | Q3UMG5 | Leucine-rich repeat and calponin homology domain-containing protein 2 | 5.86e-03 | NA | 1.27e-09 |
| 3. B | Q3V1N1 | Malignant fibrous histiocytoma-amplified sequence 1 homolog | 1.13e-02 | NA | 1.62e-09 |
| 3. B | Q80YS5 | Leucine-rich repeat-containing protein 27 | 5.36e-03 | NA | 6.41e-04 |
| 3. B | O88520 | Leucine-rich repeat protein SHOC-2 | 2.91e-03 | NA | 1.06e-11 |
| 3. B | A6NM36 | Leucine-rich repeat-containing protein 30 | 2.75e-04 | NA | 2.49e-07 |
| 3. B | Q6K7R2 | Plant intracellular Ras-group-related LRR protein 6 | 5.51e-04 | NA | 1.29e-04 |
| 3. B | Q4UWF4 | Uridine 5'-monophosphate transferase | 6.07e-04 | NA | 0.002 |
| 3. B | Q15399 | Toll-like receptor 1 | 2.18e-02 | NA | 0.030 |
| 3. B | B0BLW3 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 2.29e-02 | NA | 0.016 |
| 3. B | Q9SHI2 | Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 | 6.95e-02 | NA | 0.016 |
| 3. B | P14605 | Adenylate cyclase | 8.21e-02 | NA | 2.17e-06 |
| 3. B | Q9WVC1 | Slit homolog 2 protein (Fragment) | 7.51e-03 | NA | 0.027 |
| 3. B | Q9Z1P4 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 3.33e-02 | NA | 0.002 |
| 3. B | Q4H4B6 | Protein scribble homolog | 9.54e-02 | NA | 9.33e-07 |
| 3. B | C0LGT6 | LRR receptor-like serine/threonine-protein kinase EFR | 2.61e-02 | NA | 0.003 |
| 3. B | Q6GPJ5 | Leucine-rich repeat-containing protein 40 | 5.36e-03 | NA | 4.48e-11 |
| 3. B | Q8TF66 | Leucine-rich repeat-containing protein 15 | 6.89e-03 | NA | 0.031 |
| 3. B | B5DX45 | Leucine-rich repeat protein soc-2 homolog | 8.74e-04 | NA | 1.63e-12 |
| 3. B | Q6DHL5 | Leucine-rich repeat-containing protein 57 | 2.84e-08 | NA | 3.28e-10 |
| 3. B | Q55CS7 | MAP kinase phosphatase with leucine-rich repeats protein 1 | 1.05e-02 | NA | 2.22e-04 |
| 3. B | O15335 | Chondroadherin | 4.15e-03 | NA | 5.71e-05 |
| 3. B | O55226 | Chondroadherin | 2.97e-03 | NA | 2.95e-04 |
| 3. B | Q42371 | LRR receptor-like serine/threonine-protein kinase ERECTA | 1.29e-02 | NA | 2.44e-05 |
| 3. B | Q9RBS2 | Protein PopC | 7.31e-02 | NA | 7.72e-05 |
| 3. B | Q9HB75 | p53-induced death domain-containing protein 1 | 3.63e-02 | NA | 2.90e-11 |
| 3. B | Q3UHC2 | Leucine-rich repeat serine/threonine-protein kinase 1 | 2.49e-01 | NA | 0.007 |
| 3. B | B4N9T4 | Leucine-rich repeat protein soc-2 homolog | 1.10e-03 | NA | 2.03e-12 |
| 3. B | A1CW67 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.69e-02 | NA | 0.034 |
| 3. B | Q3UV48 | Leucine-rich repeat-containing protein 30 | 4.32e-04 | NA | 2.84e-08 |
| 3. B | Q3KQF4 | Leucine-rich repeat-containing protein 69 | 1.50e-05 | NA | 6.51e-09 |
| 3. B | Q9BTT6 | Leucine-rich repeat-containing protein 1 | 6.16e-04 | NA | 2.19e-08 |
| 3. B | B3P3E8 | Leucine-rich repeat protein soc-2 homolog | 2.51e-04 | NA | 8.45e-13 |
| 3. B | F1MCA7 | Leucine-rich repeat-containing protein 7 | 9.80e-02 | NA | 1.05e-09 |
| 3. B | Q24K06 | Leucine-rich repeat-containing protein 10 | 2.51e-05 | NA | 4.35e-11 |
| 3. B | Q9LY03 | Probable LRR receptor-like serine/threonine-protein kinase IRK | 4.90e-02 | NA | 5.55e-04 |
| 3. B | P0C7J6 | Leucine-rich repeat and fibronectin type III domain-containing protein 1 | 1.27e-02 | NA | 0.003 |
| 3. B | Q9NR96 | Toll-like receptor 9 | 3.31e-02 | NA | 0.028 |
| 3. B | A8JAM0 | Dynein regulatory complex subunit 7 (Fragment) | 4.69e-03 | NA | 5.02e-12 |
| 3. B | Q4R6F0 | Leucine-rich repeat and death domain-containing protein 1 | 2.90e-03 | NA | 1.69e-12 |
| 3. B | Q96NW7 | Leucine-rich repeat-containing protein 7 | 1.67e-01 | NA | 1.74e-09 |
| 3. B | Q6UWE0 | E3 ubiquitin-protein ligase LRSAM1 | 1.12e-04 | NA | 1.68e-07 |
| 3. B | Q6JN47 | Receptor-like protein EIX1 | 3.99e-02 | NA | 0.012 |
| 3. B | F1MLX5 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 4.19e-02 | NA | 0.002 |
| 3. B | Q27972 | Chondroadherin | NA | NA | 1.17e-04 |
| 3. B | F4HX15 | Phospholipase A I | 1.30e-01 | NA | 5.72e-04 |
| 3. B | Q8BVU0 | DISP complex protein LRCH3 | 1.45e-03 | NA | 7.12e-08 |
| 3. B | Q2WF71 | Leucine-rich repeat and fibronectin type III domain-containing protein 1 | 9.35e-02 | NA | 0.003 |
| 3. B | Q8TDW0 | Volume-regulated anion channel subunit LRRC8C | 6.75e-03 | NA | 3.98e-08 |
| 3. B | Q15404 | Ras suppressor protein 1 | 3.03e-08 | NA | 6.33e-12 |
| 3. B | Q8BGR2 | Volume-regulated anion channel subunit LRRC8D | 6.30e-02 | NA | 4.12e-08 |
| 3. B | Q55FD8 | Ras guanine nucleotide exchange factor V | 1.06e-01 | NA | 3.56e-07 |
| 3. B | Q5M8G4 | Leucine-rich repeat-containing protein 40 | 1.11e-03 | NA | 3.48e-10 |
| 3. B | Q9BXB1 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 3.83e-02 | NA | 0.003 |
| 3. B | E5DHB5 | Leucine-rich repeat-containing G-protein coupled receptor 5A | 2.01e-02 | NA | 7.57e-04 |
| 3. B | A8XWW4 | Leucine-rich repeat protein soc-2 | 1.87e-03 | NA | 8.83e-08 |
| 3. B | Q55CS8 | MAP kinase phosphatase with leucine-rich repeats protein 2 | 7.62e-03 | NA | 1.88e-04 |
| 3. B | Q505F5 | Leucine-rich repeat-containing protein 47 | 4.22e-03 | NA | 3.36e-05 |
| 3. B | Q96AG4 | Leucine-rich repeat-containing protein 59 | 1.10e-03 | NA | 0.014 |
| 3. B | Q55E58 | Probable serine/threonine-protein kinase pats1 | NA | NA | 1.52e-08 |
| 3. B | Q54Y32 | MAP kinase phosphatase with leucine-rich repeats protein 3 | 2.02e-03 | NA | 2.27e-04 |
| 3. B | A2ARI4 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 1.86e-02 | NA | 1.48e-04 |
| 3. B | Q5ZLN0 | Leucine-rich repeat-containing protein 40 | 2.66e-03 | NA | 4.13e-09 |
| 3. B | Q6NU09 | Volume-regulated anion channel subunit LRRC8E | 4.18e-02 | NA | 1.60e-06 |
| 3. B | Q810B8 | SLIT and NTRK-like protein 4 | 2.03e-02 | NA | 0.023 |
| 3. B | Q9C0I9 | Leucine-rich repeat-containing protein 27 | 2.45e-02 | NA | 0.011 |
| 3. B | Q01730 | Ras suppressor protein 1 | 3.35e-07 | NA | 1.72e-09 |
| 3. B | B7XK66 | Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 4.97e-03 | NA | 8.08e-06 |
| 3. B | P07359 | Platelet glycoprotein Ib alpha chain | 1.04e-02 | NA | 1.95e-04 |
| 3. B | Q9LJF3 | Receptor-like protein kinase BRI1-like 3 | NA | NA | 0.010 |
| 3. B | P70587 | Leucine-rich repeat-containing protein 7 | 1.07e-01 | NA | 4.25e-09 |
| 3. B | Q9WTR8 | PH domain leucine-rich repeat protein phosphatase 1 | 1.49e-01 | NA | 4.34e-10 |
| 3. B | Q22875 | Leucine-rich repeat protein soc-2 | 4.74e-03 | NA | 4.45e-08 |
| 3. B | B4PU77 | Leucine-rich repeat protein soc-2 homolog | 1.61e-03 | NA | 8.69e-13 |
| 3. B | Q7XA40 | Putative disease resistance protein RGA3 | 4.15e-02 | NA | 0.004 |
| 3. B | Q6NSJ5 | Volume-regulated anion channel subunit LRRC8E | 5.69e-03 | NA | 7.07e-08 |
| 3. B | Q8N9N7 | Leucine-rich repeat-containing protein 57 | 1.77e-06 | NA | 8.96e-10 |
| 3. B | A6NIK2 | Leucine-rich repeat-containing protein 10B | 5.14e-05 | NA | 2.47e-07 |
| 3. B | Q9BXR5 | Toll-like receptor 10 | 1.32e-02 | NA | 0.002 |
| 3. B | F1MT22 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 3.99e-02 | NA | 3.53e-05 |
| 3. B | Q9LJM4 | Receptor-like protein kinase HAIKU2 | 3.03e-02 | NA | 0.043 |
| 3. B | O64566 | Plant intracellular Ras-group-related LRR protein 6 | 1.42e-04 | NA | 4.49e-09 |
| 3. B | Q8K3W2 | Leucine-rich repeat-containing protein 10 | 5.52e-06 | NA | 1.16e-12 |
| 3. B | P0C895 | LRR repeats and ubiquitin-like domain-containing protein At2g30105 | 1.77e-05 | NA | 8.99e-09 |
| 3. B | Q9XIL9 | Pollen-specific leucine-rich repeat extensin-like protein 3 | 2.27e-02 | NA | 4.49e-05 |
| 3. B | Q9FL28 | LRR receptor-like serine/threonine-protein kinase FLS2 | 1.01e-01 | NA | 6.73e-04 |
| 3. B | Q9R1B9 | Slit homolog 2 protein | 1.58e-01 | NA | 0.014 |
| 3. B | Q13045 | Protein flightless-1 homolog | 1.79e-02 | NA | 1.31e-05 |
| 3. B | Q8K3P5 | CCR4-NOT transcription complex subunit 6 | 2.18e-02 | NA | 1.68e-05 |
| 3. B | P51890 | Lumican | 3.12e-03 | NA | 3.29e-04 |
| 3. B | Q9ERV7 | p53-induced death domain-containing protein 1 | 2.25e-02 | NA | 2.80e-12 |
| 3. B | Q5RFS0 | Protein Abitram | 9.59e-01 | NA | 2.39e-17 |
| 3. B | D4A1J9 | Leucine-rich repeat and fibronectin type-III domain-containing protein 5 | 1.91e-02 | NA | 1.64e-04 |
| 3. B | Q5BJ41 | CCR4-NOT transcription complex subunit 6 | 1.15e-02 | NA | 1.70e-05 |
| 3. B | P0CP23 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.04e-02 | NA | 0.002 |
| 3. B | Q9H9A6 | Leucine-rich repeat-containing protein 40 | 3.59e-03 | NA | 3.81e-09 |
| 3. B | Q9DBY4 | TLR4 interactor with leucine rich repeats | 6.75e-02 | NA | 0.002 |
| 3. B | O94294 | Leucine-rich repeat-containing protein sog2 | 1.84e-01 | NA | 2.49e-05 |
| 3. B | Q54M77 | Probable serine/threonine-protein kinase roco8 | 3.51e-01 | NA | 1.51e-06 |
| 3. B | Q6INV3 | Leucine-rich repeat-containing protein 57 | 5.67e-08 | NA | 2.08e-08 |
| 3. B | Q9SZA7 | Probable disease resistance protein At4g33300 | 9.58e-02 | NA | 0.005 |
| 3. B | F4K6B8 | Leucine-rich repeat receptor-like serine/threonine-protein kinase RGI4 | 3.85e-02 | NA | 0.003 |
| 3. B | Q9Y4C4 | Malignant fibrous histiocytoma-amplified sequence 1 | 1.07e-02 | NA | 1.75e-12 |
| 3. B | Q66JT1 | Volume-regulated anion channel subunit LRRC8E | 2.96e-02 | NA | 1.20e-06 |
| 3. B | Q9ULM6 | CCR4-NOT transcription complex subunit 6 | 4.13e-02 | NA | 4.07e-04 |
| 3. B | Q9LHP4 | LRR receptor-like serine/threonine-protein kinase RGI1 | 6.59e-02 | NA | 0.021 |
| 3. B | Q80X72 | Leucine-rich repeat-containing protein 15 | 3.17e-03 | NA | 1.60e-04 |
| 3. B | Q14160 | Protein scribble homolog | 1.33e-01 | NA | 1.73e-07 |
| 3. B | Q9V780 | Protein lap1 | 1.02e-02 | NA | 3.38e-09 |
| 3. B | Q7KRY7 | Protein lap4 | 1.43e-01 | NA | 7.00e-10 |
| 3. B | Q01631 | Adenylate cyclase | 3.31e-01 | NA | 1.27e-08 |
| 3. B | Q6XHA7 | Probable serine/threonine-protein kinase roco9 | NA | NA | 8.83e-11 |
| 3. B | Q8RWE5 | Plant intracellular Ras-group-related LRR protein 8 | 2.09e-04 | NA | 3.19e-09 |
| 3. B | P0DO09 | Disease resistance protein Piks-1 | 5.52e-02 | NA | 2.08e-08 |
| 3. B | Q6PGX3 | Leucine-rich repeat and fibronectin type III domain-containing protein 1 | 9.18e-03 | NA | 0.030 |
| 3. B | F7D3V9 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 2.99e-02 | NA | 0.001 |
| 3. B | Q1ENI8 | Peroxidasin homolog pxn-1 | 9.60e-02 | NA | 0.014 |
| 3. B | A6H6A4 | Leucine-rich repeat and IQ domain-containing protein 4 | 6.44e-03 | NA | 1.42e-09 |
| 3. B | Q5BKY1 | Leucine-rich repeat-containing protein 10 | 2.02e-06 | NA | 2.23e-11 |
| 3. B | Q3TX51 | Leucine-rich repeat-containing protein 28 | 5.74e-04 | NA | 1.03e-06 |
| 3. B | Q9ZWC8 | Serine/threonine-protein kinase BRI1-like 1 | 6.78e-02 | NA | 0.006 |
| 3. B | Q1EA11 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 3.08e-02 | NA | 0.014 |
| 3. B | P59383 | Leucine-rich repeat neuronal protein 4 | 1.05e-02 | NA | 0.012 |
| 3. B | Q5RJR8 | Leucine-rich repeat-containing protein 59 | 1.52e-03 | NA | 0.018 |
| 3. B | O88279 | Slit homolog 1 protein | 4.95e-01 | NA | 0.015 |
| 3. B | P49606 | Adenylate cyclase | 3.92e-01 | NA | 6.31e-06 |
| 3. B | Q9HBX8 | Leucine-rich repeat-containing G-protein coupled receptor 6 | 7.19e-02 | NA | 0.003 |
| 3. B | O88280 | Slit homolog 3 protein | 2.45e-01 | NA | 7.93e-05 |
| 3. B | Q3UGP9 | Leucine-rich repeat-containing protein 58 | 5.55e-05 | NA | 2.76e-10 |
| 3. B | Q9WVB4 | Slit homolog 3 protein | 2.86e-01 | NA | 4.83e-05 |
| 3. B | B4LXW1 | Leucine-rich repeat protein soc-2 homolog | 6.84e-04 | NA | 8.39e-13 |
| 3. B | Q9Z2H4 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 3.25e-02 | NA | 8.35e-04 |
| 3. B | Q8CHE4 | PH domain leucine-rich repeat-containing protein phosphatase 1 | 2.92e-02 | NA | 1.17e-10 |
| 3. B | Q3ZC49 | Leucine-rich repeat-containing protein 39 | 8.45e-05 | NA | 2.34e-07 |
| 3. B | Q6GLE8 | Leucine-rich repeat-containing protein 28 | 8.75e-06 | NA | 2.35e-07 |
| 3. B | Q6CEJ6 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 8.17e-02 | NA | 0.002 |
| 3. B | Q7KIN0 | Toll-like receptor 7 | 1.79e-01 | NA | 0.005 |
| 3. B | P0DM44 | Leucine-rich repeat-containing G-protein coupled receptor 6 | 3.03e-02 | NA | 8.89e-04 |
| 3. B | Q9VEK6 | Leucine-rich repeat protein soc-2 homolog | 6.52e-03 | NA | 9.68e-13 |
| 3. B | A7SFP1 | Leucine-rich repeat protein soc-2 homolog | 8.42e-04 | NA | 3.30e-09 |
| 3. B | Q8VZG8 | MDIS1-interacting receptor like kinase 2 | 5.79e-02 | NA | 0.002 |
| 3. B | Q96CX6 | Leucine-rich repeat-containing protein 58 | 2.29e-04 | NA | 8.10e-11 |
| 3. B | Q96NI6 | Leucine-rich repeat and fibronectin type-III domain-containing protein 5 | 2.53e-02 | NA | 1.98e-04 |
| 3. B | O60346 | PH domain leucine-rich repeat-containing protein phosphatase 1 | 9.02e-02 | NA | 9.68e-09 |
| 3. B | Q05443 | Lumican | 1.87e-03 | NA | 0.015 |
| 3. B | Q6GV17 | Toll-like receptor 10 | 1.33e-02 | NA | 0.006 |
| 3. B | Q8BXA0 | Leucine-rich repeat and fibronectin type-III domain-containing protein 5 | 3.62e-02 | NA | 1.65e-04 |
| 3. B | Q9C7T7 | Receptor protein-tyrosine kinase CEPR2 | 3.96e-02 | NA | 0.032 |
| 3. B | Q80ZI6 | E3 ubiquitin-protein ligase LRSAM1 | 3.76e-03 | NA | 8.61e-06 |
| 3. B | O65440 | Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 | 2.47e-02 | NA | 0.041 |
| 3. B | Q80U72 | Protein scribble homolog | 4.47e-02 | NA | 1.61e-07 |
| 3. B | Q8S7M7 | Plant intracellular Ras-group-related LRR protein 5 | 8.50e-04 | NA | 9.19e-09 |
| 3. B | Q9NX38 | Protein Abitram | 9.56e-01 | NA | 2.39e-17 |
| 3. B | B0M0P8 | Ras guanine nucleotide exchange factor L | 2.53e-01 | NA | 2.65e-05 |
| 3. B | Q6XHA6 | Probable inactive serine/threonine-protein kinase roco10 | 6.49e-01 | NA | 0.010 |
| 3. B | F2VYU4 | Disease resistance protein Pik-1 | 2.05e-02 | NA | 2.19e-08 |
| 3. B | Q9SJH6 | Receptor like protein 29 | 3.79e-03 | NA | 1.31e-05 |
| 3. B | Q4WQG5 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 6.72e-02 | NA | 0.034 |
| 3. B | D0ZVG2 | E3 ubiquitin-protein ligase SspH1 | 1.66e-02 | NA | 0.036 |
| 3. B | O94813 | Slit homolog 2 protein | 2.74e-01 | NA | 0.023 |
| 3. B | A2BHJ4 | CCR4-NOT transcription complex subunit 6-like | 2.61e-02 | NA | 0.002 |
| 3. B | Q7G768 | Brassinosteroid LRR receptor kinase BRL2 | 5.30e-02 | NA | 2.62e-04 |
| 3. B | Q9D1G5 | Leucine-rich repeat-containing protein 57 | 1.53e-06 | NA | 5.42e-09 |
| 3. B | Q8IWT6 | Volume-regulated anion channel subunit LRRC8A | 5.96e-02 | NA | 3.39e-08 |
| 3. B | Q5RAV5 | Leucine-rich repeat protein SHOC-2 | 4.13e-04 | NA | 2.42e-11 |
| 3. B | Q7L1W4 | Volume-regulated anion channel subunit LRRC8D | 3.73e-02 | NA | 4.09e-08 |
| 3. B | Q8N456 | Leucine-rich repeat-containing protein 18 | 4.66e-06 | NA | 1.20e-04 |
| 3. B | P82963 | Chaoptin (Fragment) | 2.13e-02 | NA | 0.003 |
| 3. B | P02750 | Leucine-rich alpha-2-glycoprotein | 1.12e-03 | NA | 0.008 |
| 3. B | Q9CQ76 | Nephrocan | 4.53e-04 | NA | 0.009 |
| 3. B | Q9D9Q0 | Leucine-rich repeat-containing protein 69 | 2.73e-04 | NA | 5.81e-09 |
| 3. B | Q9UQ13 | Leucine-rich repeat protein SHOC-2 | 1.24e-03 | NA | 2.42e-11 |
| 3. B | Q80VQ1 | Leucine-rich repeat-containing protein 1 | 6.07e-04 | NA | 4.37e-09 |
| 3. B | Q6P4K6 | Serine/threonine-protein kinase 11-interacting protein | 4.03e-02 | NA | 0.025 |
| 3. B | Q69JN6 | Brassinosteroid LRR receptor kinase BRL1 | 1.38e-01 | NA | 0.018 |
| 3. B | P51884 | Lumican | 2.42e-03 | NA | 0.022 |
| 3. B | C0LGK9 | Probable LRR receptor-like serine/threonine-protein kinase At2g24230 | 2.67e-02 | NA | 2.31e-04 |
| 3. B | Q9P244 | Leucine-rich repeat and fibronectin type III domain-containing protein 1 | 6.53e-02 | NA | 0.003 |
| 3. B | V9M398 | Disease resistance protein RUN1 | 1.70e-01 | NA | 0.004 |
| 3. B | Q9DBB9 | Carboxypeptidase N subunit 2 | 1.19e-02 | NA | 9.61e-07 |
| 3. B | Q9VPF0 | Protein artichoke | 2.24e-01 | NA | 0.041 |
| 3. B | Q6AYI5 | Leucine-rich repeat protein SHOC-2 | 8.91e-03 | NA | 2.31e-11 |
| 3. B | Q9FRS6 | Leucine-rich repeat receptor-like protein kinase PXL1 | 5.51e-02 | NA | 2.63e-04 |
| 3. B | P08678 | Adenylate cyclase | 4.86e-01 | NA | 1.58e-06 |
| 3. B | Q5E9C0 | Ras suppressor protein 1 | 3.47e-07 | NA | 1.02e-11 |
| 3. B | P34268 | Protein flightless-1 homolog | 2.54e-02 | NA | 7.10e-09 |
| 3. B | Q80ZQ9 | Protein Abitram | 9.44e-01 | NA | 4.36e-14 |
| 3. B | F1R6I3 | Leucine-rich repeat-containing protein 39 | 2.24e-04 | NA | 1.49e-06 |
| 3. B | Q9CQ07 | Leucine-rich repeat-containing protein 18 | 5.30e-05 | NA | 3.58e-05 |
| 3. B | Q5ZHW7 | Protein Abitram | 9.42e-01 | NA | 6.72e-10 |
| 3. B | Q8W4Q3 | Plant intracellular Ras-group-related LRR protein 3 | 6.41e-04 | NA | 1.78e-10 |
| 3. B | Q9ZU46 | Receptor protein kinase-like protein ZAR1 | 1.54e-02 | NA | 0.042 |
| 3. B | Q42484 | Disease resistance protein RPS2 | 5.70e-02 | NA | 0.015 |
| 3. B | Q9SYQ8 | Receptor protein kinase CLAVATA1 | 5.48e-02 | NA | 0.006 |
| 3. B | Q8RZV7 | Leucine-rich repeat receptor protein kinase MSP1 | 1.92e-01 | NA | 0.005 |
| 3. B | Q29S16 | Protein Abitram | 9.57e-01 | NA | 9.75e-15 |
| 3. B | O61967 | Protein lap1 | 9.35e-04 | NA | 2.42e-11 |
| 3. B | Q7XA42 | Putative disease resistance protein RGA1 | 7.54e-02 | NA | 7.58e-05 |
| 3. B | Q9FK66 | Receptor-like protein 55 | 1.54e-03 | NA | 2.04e-05 |
| 3. B | Q68F79 | Volume-regulated anion channel subunit LRRC8E | 1.23e-02 | NA | 8.34e-06 |
| 3. B | O70210 | Chondroadherin | 2.91e-03 | NA | 7.95e-05 |
| 3. B | Q96JM4 | Leucine-rich repeat and IQ domain-containing protein 1 | 3.81e-01 | NA | 0.033 |
| 3. B | B4JTV9 | Leucine-rich repeat protein soc-2 homolog | 9.21e-04 | NA | 9.19e-13 |
| 3. B | Q28G67 | Protein Abitram | 9.58e-01 | NA | 1.50e-09 |
| 3. B | Q9SN46 | Leucine-rich repeat extensin-like protein 5 | 8.93e-02 | NA | 0.029 |
| 3. B | Q960C5 | Leucine-rich repeat and calponin homology domain-containing protein | 2.44e-03 | NA | 3.39e-06 |
| 3. B | Q9JJ28 | Protein flightless-1 homolog | 3.43e-02 | NA | 6.81e-04 |
| 3. B | Q9FN37 | Phytosulfokine receptor 2 | 3.88e-02 | NA | 0.021 |
| 3. B | G9LZD7 | Probable inactive leucine-rich repeat receptor kinase XIAO | 3.39e-02 | NA | 2.83e-05 |
| 3. B | B0W6M9 | Leucine-rich repeat protein soc-2 homolog | 8.10e-04 | NA | 1.02e-10 |
| 3. B | Q2QZF2 | Disease resistance protein PIK5-NP | 5.56e-02 | NA | 4.31e-07 |
| 3. B | Q9Y2L9 | Leucine-rich repeat and calponin homology domain-containing protein 1 | 1.16e-02 | NA | 1.13e-09 |
| 3. B | Q9LRT1 | Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 | 4.21e-02 | NA | 8.39e-04 |
| 3. B | O75473 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 4.11e-02 | NA | 7.65e-04 |
| 3. B | Q922Q8 | Leucine-rich repeat-containing protein 59 | 1.20e-03 | NA | 0.015 |
| 3. B | P12024 | Chaoptin | 5.19e-02 | NA | 0.018 |
| 3. B | F4HWL3 | Receptor-like protein 4 | 1.81e-01 | NA | 0.010 |
| 3. B | Q6JN46 | Receptor-like protein EIX2 | 4.29e-02 | NA | 0.002 |
| 3. B | O22476 | Protein BRASSINOSTEROID INSENSITIVE 1 | 1.39e-01 | NA | 0.003 |
| 3. B | O14498 | Immunoglobulin superfamily containing leucine-rich repeat protein | 4.56e-04 | NA | 0.009 |
| 3. B | D3ZXS4 | Leucine-rich repeat-containing protein 39 | 1.24e-04 | NA | 1.05e-07 |
| 3. B | Q9CRC8 | Leucine-rich repeat-containing protein 40 | 4.12e-03 | NA | 3.76e-07 |
| 3. B | Q9Z1S7 | Osteomodulin | 1.12e-02 | NA | 0.010 |
| 3. B | P31384 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 7.98e-02 | NA | 0.001 |
| 3. B | A4IIK1 | Malignant fibrous histiocytoma-amplified sequence 1 homolog | 1.87e-02 | NA | 1.67e-07 |
| 3. B | Q5DU41 | Volume-regulated anion channel subunit LRRC8B | 2.97e-02 | NA | 1.20e-09 |
| 3. B | O74874 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 4.31e-02 | NA | 2.07e-04 |
| 3. B | Q8SU52 | Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 7.46e-03 | NA | 3.72e-05 |
| 3. B | Q9TZM3 | Leucine-rich repeat serine/threonine-protein kinase 1 | 5.34e-01 | NA | 4.94e-04 |
| 3. B | Q54AX5 | Leucine-rich repeat protein lrrA | 4.00e-04 | NA | 1.61e-07 |
| 3. B | Q7XNY1 | Plant intracellular Ras-group-related LRR protein 1 | 3.45e-04 | NA | 3.31e-12 |
| 3. B | B9F655 | Plant intracellular Ras-group-related LRR protein 7 | 9.18e-06 | NA | 2.34e-11 |
| 3. B | C0LGR3 | LRR receptor-like serine/threonine-protein kinase RGI3 | 4.10e-02 | NA | 0.013 |
| 3. B | Q6ZVD8 | PH domain leucine-rich repeat-containing protein phosphatase 2 | 8.86e-02 | NA | 1.66e-08 |
| 3. B | B3LWU3 | Leucine-rich repeat protein soc-2 homolog | 2.90e-04 | NA | 4.32e-12 |
| 3. B | Q7XA39 | Putative disease resistance protein RGA4 | 7.60e-02 | NA | 0.008 |
| 3. B | Q1L8Y7 | Leucine-rich repeat protein SHOC-2 | 3.92e-04 | NA | 6.10e-11 |
| 3. B | B4QVR7 | Leucine-rich repeat protein soc-2 homolog | 2.05e-02 | NA | 1.03e-12 |
| 3. B | Q6P9F7 | Volume-regulated anion channel subunit LRRC8B | 3.47e-02 | NA | 6.06e-11 |
| 3. B | Q4R3P6 | Leucine-rich repeat-containing protein 40 | 2.01e-03 | NA | 1.53e-08 |
| 3. B | A8WGA3 | Leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein | 1.60e-02 | NA | 0.007 |
| 3. B | Q5FVI3 | Leucine-rich repeat-containing protein 57 | 2.30e-06 | NA | 1.11e-09 |
| 3. B | Q8GUQ5 | Brassinosteroid LRR receptor kinase | 1.43e-01 | NA | 3.09e-06 |
| 3. B | Q7F8Q9 | Leucine-rich repeat receptor protein kinase MSL1 | 2.14e-01 | NA | 1.76e-05 |
| 3. B | Q6XHB2 | Probable serine/threonine-protein kinase roco4 | 5.71e-01 | NA | 0.006 |
| 3. B | A6NIV6 | Leucine-rich repeat and IQ domain-containing protein 4 | 5.84e-03 | NA | 3.39e-13 |
| 3. B | O75093 | Slit homolog 1 protein | 5.46e-01 | NA | 0.012 |
| 3. B | P62046 | Leucine-rich repeat and calponin homology domain-containing protein 1 | 2.95e-03 | NA | 1.01e-08 |
| 3. B | Q498T9 | Volume-regulated anion channel subunit LRRC8C | 6.91e-03 | NA | 3.06e-07 |
| 3. B | Q8N1G4 | Leucine-rich repeat-containing protein 47 | 6.17e-03 | NA | 2.40e-05 |
| 3. B | Q96DD0 | Leucine-rich repeat-containing protein 39 | 6.33e-05 | NA | 1.45e-06 |
| 3. B | Q80TE7 | Leucine-rich repeat-containing protein 7 | 1.52e-01 | NA | 4.44e-09 |
| 3. B | Q9T0K5 | Leucine-rich repeat extensin-like protein 3 | 2.97e-02 | NA | 0.009 |
| 3. B | Q01513 | Adenylate cyclase | 2.63e-01 | NA | 1.20e-08 |
| 3. B | Q9S7I6 | LRR receptor-like serine/threonine-protein kinase RPK2 | 7.64e-02 | NA | 0.002 |
| 3. B | Q9ZPS9 | Serine/threonine-protein kinase BRI1-like 2 | 8.80e-02 | NA | 8.43e-04 |
| 3. B | P47735 | Receptor-like protein kinase 5 | 4.99e-02 | NA | 0.041 |
| 3. B | Q80TH2 | Erbin | 1.12e-01 | NA | 1.44e-08 |
| 3. B | C0LGV1 | LRR receptor-like serine/threonine-protein kinase RGI2 | 4.59e-02 | NA | 0.011 |
| 3. B | Q8C0R9 | Leucine-rich repeat and death domain-containing protein 1 | 8.36e-03 | NA | 9.24e-12 |
| 3. B | A4IFA6 | Immunoglobulin superfamily containing leucine-rich repeat protein | 5.72e-04 | NA | 1.44e-04 |
| 3. B | Q54WS5 | Probable serine/threonine-protein kinase roco6 | 3.81e-01 | NA | 1.31e-07 |
| 3. B | O77742 | Osteomodulin | 5.08e-03 | NA | 0.032 |
| 3. B | Q66HD6 | Leucine-rich repeat-containing protein 18 | 6.52e-05 | NA | 8.82e-05 |
| 3. B | Q8BGI7 | Leucine-rich repeat-containing protein 39 | 1.03e-04 | NA | 2.72e-07 |
| 3. B | Q3KRC6 | Volume-regulated anion channel subunit LRRC8E | 4.03e-02 | NA | 3.03e-07 |
| 3. B | Q7XDQ7 | Plant intracellular Ras-group-related LRR protein 8 | 2.30e-04 | NA | 1.98e-06 |
| 3. B | Q7XBQ9 | Disease resistance protein RGA2 | 1.19e-01 | NA | 0.009 |
| 3. B | Q8MVR1 | Cyclic GMP-binding protein C | 4.99e-01 | NA | 1.78e-04 |
| 3. B | Q6CJU4 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 2.11e-02 | NA | 0.012 |
| 3. B | Q921G6 | Leucine-rich repeat and calponin homology domain-containing protein 4 | 1.13e-04 | NA | 1.52e-09 |
| 3. B | O81765 | Pollen-specific leucine-rich repeat extensin-like protein 4 | 1.63e-02 | NA | 0.002 |
| 3. B | Q9C2R2 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.04e-01 | NA | 0.011 |
| 3. B | Q0JA29 | LRR receptor-like serine/threonine-protein kinase FLS2 | 4.30e-02 | NA | 0.008 |
| 3. B | Q4V8I7 | Volume-regulated anion channel subunit LRRC8A | 1.13e-01 | NA | 1.03e-08 |
| 3. B | E7FE13 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 4.35e-02 | NA | 4.49e-04 |
| 3. B | C0LGJ1 | Probable LRR receptor-like serine/threonine-protein kinase At1g74360 | 7.95e-02 | NA | 0.010 |
| 3. B | Q9FIZ3 | LRR receptor-like serine/threonine-protein kinase GSO2 | 1.11e-01 | NA | 0.001 |
| 3. B | A6QLV3 | Leucine-rich repeat protein SHOC-2 | 5.37e-04 | NA | 2.42e-11 |
| 3. B | C0LGS3 | Probable LRR receptor-like serine/threonine-protein kinase At4g37250 | 2.48e-02 | NA | 0.034 |
| 3. B | A5PK13 | Volume-regulated anion channel subunit LRRC8C | 6.89e-03 | NA | 4.02e-08 |
| 3. B | Q6AXU9 | CCR4-NOT transcription complex subunit 6 | 2.05e-02 | NA | 1.68e-05 |
| 3. B | Q86X40 | Leucine-rich repeat-containing protein 28 | 2.84e-04 | NA | 1.03e-04 |
| 3. B | C4V7I7 | Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 4.70e-03 | NA | 4.14e-04 |
| 3. B | C0LGP9 | Probable leucine-rich repeat receptor-like protein kinase IMK3 | 1.49e-02 | NA | 0.015 |
| 3. B | C0LGQ5 | LRR receptor-like serine/threonine-protein kinase GSO1 | 8.99e-02 | NA | 1.97e-05 |
| 3. B | Q8IW52 | SLIT and NTRK-like protein 4 | 3.51e-02 | NA | 0.020 |
| 3. B | Q0CT27 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 4.13e-02 | NA | 0.018 |
| 3. B | Q6GU68 | Immunoglobulin superfamily containing leucine-rich repeat protein | 4.14e-04 | NA | 4.01e-04 |
| 3. B | Q3UVD5 | Leucine-rich repeat-containing G-protein coupled receptor 6 | 2.50e-02 | NA | 0.010 |
| 3. B | O35103 | Osteomodulin | 3.16e-03 | NA | 0.043 |
| 3. B | Q5U308 | Volume-regulated anion channel subunit LRRC8D | 3.01e-02 | NA | 1.09e-08 |
| 3. B | Q496Z2 | TLR4 interactor with leucine rich repeats | 3.56e-02 | NA | 0.004 |
| 3. B | Q1ZXD6 | Probable serine/threonine-protein kinase roco5 | NA | NA | 1.44e-08 |
| 3. B | Q8BXA7 | PH domain leucine-rich repeat-containing protein phosphatase 2 | 7.72e-02 | NA | 1.77e-09 |
| 3. B | Q5B778 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.46e-01 | NA | 0.017 |
| 3. B | Q09564 | Protein phosphatase PHLPP-like protein | 6.75e-02 | NA | 4.40e-05 |
| 3. B | D4AC13 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 4.25e-02 | NA | 7.65e-04 |
| 3. B | A0A290U7C4 | Disease resistance protein Roq1 | 5.94e-02 | NA | 0.014 |
| 3. B | Q6P3Y9 | Podocan-like protein 1 | 5.27e-03 | NA | 0.005 |
| 3. B | A4D1F6 | Leucine-rich repeat and death domain-containing protein 1 | 3.14e-02 | NA | 2.28e-11 |
| 3. B | Q1LU93 | Protein Abitram | 9.70e-01 | NA | 2.39e-09 |
| 3. B | Q8R502 | Volume-regulated anion channel subunit LRRC8C | 9.41e-03 | NA | 2.01e-07 |
| 3. B | Q80TR4 | Slit homolog 1 protein | 3.71e-01 | NA | 0.011 |
| 3. B | P23466 | Adenylate cyclase | 1.71e-01 | NA | 6.92e-07 |
| 3. B | Q6XHA5 | Probable serine/threonine-protein kinase roco11 | 4.49e-01 | NA | 0.002 |
| 3. B | Q5F4C4 | Leucine-rich repeat protein SHOC-2 | 6.20e-04 | NA | 5.43e-12 |
| 3. B | Q96II8 | DISP complex protein LRCH3 | 5.87e-03 | NA | 2.19e-09 |
| 3. B | Q6ZNQ3 | Leucine-rich repeat-containing protein 69 | 6.80e-05 | NA | 2.67e-04 |
| 3. B | Q54TM7 | Probable serine/threonine-protein kinase drkD | 3.97e-02 | NA | 4.29e-07 |
| 3. B | Q9M0G7 | MDIS1-interacting receptor like kinase 1 | 5.65e-02 | NA | 0.022 |
| 3. B | Q68CR7 | Leucine-rich repeat-containing protein 66 | 1.13e-02 | NA | 0.029 |
| 3. B | C0LGS2 | Probable LRR receptor-like serine/threonine-protein kinase At4g36180 | 5.32e-02 | NA | 0.014 |
| 3. B | Q9DE67 | Lumican | 3.25e-03 | NA | 3.40e-04 |
| 3. B | Q6ZH85 | Plant intracellular Ras-group-related LRR protein 2 | 3.84e-04 | NA | 1.49e-10 |
| 3. B | Q8VDB8 | Leucine-rich repeat-containing protein 2 | 2.58e-04 | NA | 9.50e-08 |
| 3. B | Q80WG5 | Volume-regulated anion channel subunit LRRC8A | 5.93e-02 | NA | 1.79e-08 |
| 3. B | O64973 | Disease resistance protein RPS5 | 1.91e-02 | NA | 0.008 |
| 3. B | Q32KX5 | Leucine-rich repeat-containing protein 28 | 5.16e-05 | NA | 0.001 |