Summary

Q08AI8

Homolog: A8E4S7.
Function: Protein mab-21-like 3.

Statistics

Total GO Annotation: 91
Unique PROST Go: 81
Unique BLAST Go: 1

Total Homologs: 95
Unique PROST Homologs: 87
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A8E4S7 (Protein mab-21-like 3) with a FATCAT P-Value: 0.0 and RMSD of 3.08 angstrom. The sequence alignment identity is 22.4%.
Structural alignment shown in left. Query protein Q08AI8 colored as red in alignment, homolog A8E4S7 colored as blue. Query protein Q08AI8 is also shown in right top, homolog A8E4S7 showed in right bottom. They are colored based on secondary structures. 

  Q08AI8 MPAPALPTSAM--AVQVPLWHHYL--QA-IRSREAPRA-QDFQRAENVL--LTVLERVHALDPRF--IVDYSRGLEAFQFALRSSEDPMDMEVPLWVDAE 90
  A8E4S7 ----------MTNCTDEDL-DNYLLNQVDLRHRQVSKCVEDVQK---IIKDLTT--EVSSKDARFQSIA--NAGVH--NASLK--DQPALMSK--W---S 73

  Q08AI8 ALL----IEEPEATQ---PEDGLELCHLGVPREG-AGL-ER----W---T-T---------E----------DTF-TASSEG-DAKC--RGHIVPSKVLC 150
  A8E4S7 ALLRGRCAYNP-AIQVLSP--TLYL--ISVPLQGLMGYKERRTRQWRYYTLTGSRLLSPVREPEKLHQWLELESFVNPSQEWHDARMTIEGDIVPAKVVN 168

  Q08AI8 VLKDLLVAAIVHCKHHSLIAPGSLNAASLREEQLHLSLLVSSGWRTISFHV-VPV----VRRKLGAPALEGVQQMP---GFPEGSL-RR---------IL 232
  A8E4S7 VFKDLLETSI---KTR-----GLTN---------KVSVLESVG--T-AVRVAVETSEAQIEVKL-VPTVELMNYWPKRARWP--RLFRRWPSTERARCIK 245

  Q08AI8 SQGVDLVPASAQL-WRTS---TDYLLTRLLGELGSLQGHRLDSLSILDRVNHESWRDSGQTDGLT-FGHLKMVLLWASVLFLAPEDWAELQGAVYRLLVV 327
  A8E4S7 SFGFNLM-ASSNYHWLLSFSRAEQVLLSNIDEDG---GCRRKCYRVVRQLKEDGW-CPGSKPVITAF-HLQTLLFWTCEKYPCTRDWKDFRGCVLRLVQK 339

  Q08AI8 LLCCLATRKLPH-FLHPQRNLLQGSGL-DLGAIYQRVEGFASQPEAALRIHATHLGRSPPPRIGSGLKALLQLPASDPTYWATAYFDVLLDKFQVFNIQD 425
  A8E4S7 LHKCVSQHYLRHYFIR-SHNLLKYSNTNELDEVAKKINHFLENP--GTYIH------------------------------------------------- 387

  Q08AI8 KDRISAMQSIFQKTRTLGGEES 447
  A8E4S7 ---------------------- 387

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0002089 lens morphogenesis in camera-type eye
1. PB GO:0043010 camera-type eye development
1. PB GO:0061303 cornea development in camera-type eye
1. PB GO:0048701 embryonic cranial skeleton morphogenesis
1. PB GO:0001654 eye development
1. PB GO:0060041 retina development in camera-type eye
1. PB GO:0061386 closure of optic fissure
1. PB GO:0048484 enteric nervous system development
1. PB GO:0048048 embryonic eye morphogenesis
2. P GO:0140374 antiviral innate immune response
2. P GO:0034142 toll-like receptor 4 signaling pathway
2. P GO:0016779 nucleotidyltransferase activity
2. P GO:0061501 2',3'-cyclic GMP-AMP synthase activity
2. P GO:0032760 positive regulation of tumor necrosis factor production
2. P GO:0004652 polynucleotide adenylyltransferase activity
2. P GO:0035458 cellular response to interferon-beta
2. P GO:0050730 regulation of peptidyl-tyrosine phosphorylation
2. P GO:0031508 pericentric heterochromatin assembly
2. P GO:0009190 cyclic nucleotide biosynthetic process
2. P GO:0004605 phosphatidate cytidylyltransferase activity
2. P GO:0001701 in utero embryonic development
2. P GO:0070106 interleukin-27-mediated signaling pathway
2. P GO:0010172 embryonic body morphogenesis
2. P GO:0098586 cellular response to virus
2. P GO:2000406 positive regulation of T cell migration
2. P GO:0071046 nuclear polyadenylation-dependent ncRNA catabolic process
2. P GO:0043631 RNA polyadenylation
2. P GO:0005634 nucleus
2. P GO:2000342 negative regulation of chemokine (C-X-C motif) ligand 2 production
2. P GO:0048255 mRNA stabilization
2. P GO:0071639 positive regulation of monocyte chemotactic protein-1 production
2. P GO:0050265 RNA uridylyltransferase activity
2. P GO:0003723 RNA binding
2. P GO:0031499 TRAMP complex
2. P GO:0048525 negative regulation of viral process
2. P GO:1990817 RNA adenylyltransferase activity
2. P GO:0001730 2'-5'-oligoadenylate synthetase activity
2. P GO:0042593 glucose homeostasis
2. P GO:0031048 heterochromatin assembly by small RNA
2. P GO:0045785 positive regulation of cell adhesion
2. P GO:0051607 defense response to virus
2. P GO:0060337 type I interferon signaling pathway
2. P GO:0003725 double-stranded RNA binding
2. P GO:0045071 negative regulation of viral genome replication
2. P GO:0036450 polyuridylation-dependent decapping of nuclear-transcribed mRNA
2. P GO:0036416 tRNA stabilization
2. P GO:0031123 RNA 3'-end processing
2. P GO:0016020 membrane
2. P GO:0035580 specific granule lumen
2. P GO:0034138 toll-like receptor 3 signaling pathway
2. P GO:0002134 UTP binding
2. P GO:0060700 regulation of ribonuclease activity
2. P GO:1901857 positive regulation of cellular respiration
2. P GO:0071659 negative regulation of IP-10 production
2. P GO:0031314 extrinsic component of mitochondrial inner membrane
2. P GO:0000166 nucleotide binding
2. P GO:0010820 positive regulation of T cell chemotaxis
2. P GO:0005525 GTP binding
2. P GO:0060339 negative regulation of type I interferon-mediated signaling pathway
2. P GO:0001542 ovulation from ovarian follicle
2. P GO:0043129 surfactant homeostasis
2. P GO:0042981 regulation of apoptotic process
2. P GO:1901028 regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
2. P GO:0008284 positive regulation of cell population proliferation
2. P GO:0032728 positive regulation of interferon-beta production
2. P GO:1990904 ribonucleoprotein complex
2. P GO:0019898 extrinsic component of membrane
2. P GO:0009792 embryo development ending in birth or egg hatching
2. P GO:0016024 CDP-diacylglycerol biosynthetic process
2. P GO:0009117 nucleotide metabolic process
2. P GO:0035457 cellular response to interferon-alpha
2. P GO:0005739 mitochondrion
2. P GO:0031380 nuclear RNA-directed RNA polymerase complex
2. P GO:0020023 kinetoplast
2. P GO:1904724 tertiary granule lumen
2. P GO:0046872 metal ion binding
2. P GO:0052621 diguanylate cyclase activity
2. P GO:0045087 innate immune response
2. P GO:0034097 response to cytokine
2. P GO:0071076 RNA 3' uridylation
2. P GO:0009615 response to virus
2. P GO:0097222 mitochondrial mRNA polyadenylation
2. P GO:0045165 cell fate commitment
2. P GO:0032049 cardiolipin biosynthetic process
2. P GO:0045893 positive regulation of transcription, DNA-templated
2. P GO:0031379 RNA-directed RNA polymerase complex
2. P GO:0005730 nucleolus
2. P GO:0050922 negative regulation of chemotaxis
2. P GO:0031019 mitochondrial mRNA editing complex
2. P GO:0005654 nucleoplasm
3. B GO:0002088 lens development in camera-type eye

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A8E4S7 Protein mab-21-like 3 0.00e+00 1.48e-17 1.32e-09
1. PB Q6GNM3 Protein mab-21-like 3 0.00e+00 1.38e-20 0.005
1. PB Q8UUZ1 Protein mab-21-like 2 1.31e-14 5.33e-19 0.024
1. PB Q08AI8 Protein mab-21-like 4 0 2.32e-137 0.0
1. PB Q8N8X9 Protein mab-21-like 3 NA 1.69e-24 1.16e-09
1. PB Q8CI17 Protein mab-21-like 3 0.00e+00 2.61e-05 3.45e-13
1. PB A4IIW0 Protein mab-21-like 2 1.19e-14 1.98e-19 0.034
1. PB Q8CEZ4 Protein mab-21-like 4 0.00e+00 5.43e-76 0.0
2. P A4FV14 Putative nucleotidyltransferase MAB21L1 1.55e-15 2.26e-18 NA
2. P Q6DJM2 Phosphatidate cytidylyltransferase, mitochondrial 1.57e-01 8.19e-04 NA
2. P P0DSP3 Cyclic dipyrimidine nucleotide synthase 1.00e-05 5.95e-12 NA
2. P Q5RFJ1 Interleukin enhancer-binding factor 2 2.37e-03 6.97e-10 NA
2. P Q3B7H2 Phosphatidate cytidylyltransferase, mitochondrial 1.66e-01 5.08e-04 NA
2. P O46102 Poly(A) RNA polymerase, mitochondrial 7.86e-02 9.69e-04 NA
2. P Q96A09 Terminal nucleotidyltransferase 5B 7.61e-02 6.04e-07 NA
2. P Q8VI95 Inactive 2'-5'-oligoadenylate synthase 1D 5.64e-03 3.02e-22 NA
2. P Q3TUH1 Phosphatidate cytidylyltransferase, mitochondrial 2.50e-01 5.78e-03 NA
2. P Q0IES8 Protein mab-21 1.69e-14 2.60e-17 NA
2. P Q1LZD1 Transmembrane protein 102 9.74e-08 7.28e-14 NA
2. P Q60856 Inactive 2'-5'-oligoadenylate synthase 1B 1.12e-03 9.58e-20 NA
2. P P11928 2'-5'-oligoadenylate synthase 1A 4.23e-03 8.75e-17 NA
2. P Q5XIV0 Terminal nucleotidyltransferase 5C 7.51e-02 8.85e-13 NA
2. P P51006 Poly(A) polymerase type 3 (Fragment) 4.84e-03 9.73e-03 NA
2. P Q05961 2'-5'-oligoadenylate synthase 1A 3.99e-03 2.22e-18 NA
2. P Q86MV5 Terminal uridylyltransferase 2 8.33e-03 2.01e-09 NA
2. P Q29H56 Protein mab-21 1.29e-14 1.11e-15 NA
2. P Q13394 Putative nucleotidyltransferase MAB21L1 1.89e-15 2.26e-18 NA
2. P D3ZKT0 Phosphatidate cytidylyltransferase, mitochondrial 2.06e-01 6.65e-03 NA
2. P Q9Y586 Protein mab-21-like 2 1.20e-14 1.76e-18 NA
2. P Q3UPR7 Transmembrane protein 102 5.49e-08 1.96e-07 NA
2. P Q5TW90 Protein mab-21 1.37e-14 2.45e-18 NA
2. P O13833 Terminal uridylyltransferase cid1 5.13e-03 1.86e-03 NA
2. P O70299 Putative nucleotidyltransferase MAB21L1 1.89e-15 2.26e-18 NA
2. P A0A381HBN1 c-di-GMP synthase 1.57e-04 1.48e-06 NA
2. P P0DTF7 Cyclic AMP-AMP-AMP synthase 4.10e-05 6.36e-10 NA
2. P Q0IES7 Protein mab-21-like 4.22e-15 3.28e-19 NA
2. P P0DSP4 Cyclic AMP-AMP-GMP synthase 6.34e-04 4.25e-13 NA
2. P Q8N9M5 Transmembrane protein 102 8.09e-08 1.89e-10 NA
2. P Q61X59 Phosphatidate cytidylyltransferase, mitochondrial 2.11e-01 6.14e-04 NA
2. P Q9VC07 Inactive non-canonical poly(A) RNA polymerase protein Trf4-2 6.97e-03 2.37e-02 NA
2. P Q29599 2'-5'-oligoadenylate synthase 1 4.17e-03 2.95e-17 NA
2. P Q9Y106 Protein mab-21-like 1.07e-14 1.38e-18 NA
2. P Q6XGD8 Cyclic GMP-AMP synthase 2.15e-04 2.03e-14 NA
2. P O10278 Putative early 40.3 kDa protein NA 5.24e-04 NA
2. P Q6GQD9 Putative nucleotidyltransferase MAB21L1 1.29e-14 1.31e-18 NA
2. P Q8AY65 Putative nucleotidyltransferase MAB21L1 4.22e-15 2.26e-18 NA
2. P Q4R8X4 Terminal nucleotidyltransferase 5C 1.39e-01 1.11e-12 NA
2. P P00973 2'-5'-oligoadenylate synthase 1 4.67e-03 1.55e-08 NA
2. P Q5VWP2 Terminal nucleotidyltransferase 5C 1.26e-01 7.07e-14 NA
2. P A0A150XSC5 c-di-GMP synthase 1.60e-05 2.33e-08 NA
2. P Q6DCQ5 Protein mab-21-like 2-B 1.05e-14 2.23e-19 NA
2. P Q6NZ06 Interleukin enhancer-binding factor 2 homolog 1.60e-03 2.67e-06 NA
2. P Q0V9X7 Putative nucleotidyltransferase MAB21L1 1.05e-14 5.42e-19 NA
2. P P0DSP2 Cyclic dipurine nucleotide synthase 1.54e-07 6.12e-12 NA
2. P P0DUE3 c-di-GMP synthase 2.51e-05 9.31e-05 NA
2. P Q29H55 Protein mab-21-like 5.77e-15 2.64e-19 NA
2. P Q29RH2 Terminal nucleotidyltransferase 5B 8.73e-02 5.70e-09 NA
2. P D7Y2H2 Cyclic AMP-AMP-AMP synthase 2.49e-06 1.09e-18 NA
2. P Q8C525 Protein MB21D2 2.94e-08 1.71e-22 NA
2. P Q9U3W6 Protein mab-21 1.27e-14 1.73e-16 NA
2. P G2SLH8 Cyclic UMP-AMP synthase 9.33e-07 7.81e-09 NA
2. P Q9VG73 Interleukin enhancer-binding factor 2 homolog 1.17e-03 1.15e-05 NA
2. P Q6P8G1 Interleukin enhancer-binding factor 2 homolog 7.02e-03 2.73e-05 NA
2. P Q6XGD5 Cyclic UMP-AMP synthase 5.17e-07 4.74e-14 NA
2. P C0VHD2 Cyclic AMP-AMP-AMP synthase 3.92e-05 2.15e-11 NA
2. P Q8C152 Terminal nucleotidyltransferase 5B 6.16e-02 4.95e-06 NA
2. P Q924S2 Inactive 2'-5' oligoadenylate synthetase 1C 2.62e-03 3.30e-17 NA
2. P Q5UQX5 Uncharacterized protein R883 NA 2.84e-03 NA
2. P Q9GQ38 Protein male abnormal 21 1.37e-14 5.06e-22 NA
2. P Q9CXY6 Interleukin enhancer-binding factor 2 4.32e-03 6.97e-10 NA
2. P Q8IYB1 Protein MB21D2 3.85e-08 1.36e-31 NA
2. P Q9I9K2 Protein mab-21-like 2-A 1.13e-14 4.58e-18 NA
2. P Q8NEK8 Terminal nucleotidyltransferase 5D 9.54e-02 1.85e-14 NA
2. P P12828 Protein AC18 NA 2.61e-06 NA
2. P R8NBN0 Probable cyclic nucleotide synthase IK1_05630 7.29e-08 1.29e-08 NA
2. P Q12905 Interleukin enhancer-binding factor 2 4.65e-03 6.97e-10 NA
2. P Q5SSF7 Terminal nucleotidyltransferase 5C 6.62e-02 1.46e-12 NA
2. P Q7QHX4 Protein mab-21-like 8.33e-15 3.82e-18 NA
2. P Q7ZUP1 Terminal nucleotidyltransferase 5C 6.48e-02 4.21e-14 NA
2. P Q3UV16 Inositol 1,4,5-trisphosphate receptor-interacting protein-like 2 1.98e-07 5.68e-05 NA
2. P Q381M1 Terminal uridylyltransferase 4 4.32e-03 1.11e-09 NA
2. P Q8BPP1 Protein mab-21-like 2 1.22e-14 2.08e-18 NA
2. P Q9KVG7 Cyclic GMP-AMP synthase 5.29e-04 6.57e-11 NA
2. P Q20054 Protein male abnormal 21 1.39e-14 1.21e-20 NA
2. P Q8INF2 Phosphatidate cytidylyltransferase, mitochondrial 3.68e-01 1.84e-03 NA
2. P Q5BKD0 Inactive 2'-5'-oligoadenylate synthase 1B 1.20e-03 1.50e-14 NA
2. P Q6NYB4 Putative nucleotidyltransferase MAB21L1 1.20e-14 2.26e-18 NA
2. P Q3MIP1 Inositol 1,4,5-trisphosphate receptor-interacting protein-like 2 5.03e-09 4.65e-05 NA
2. P Q9N4G7 Phosphatidate cytidylyltransferase, mitochondrial 2.25e-01 5.84e-04 NA
2. P O74518 Poly(A) RNA polymerase cid12 1.40e-02 1.48e-06 NA
2. P P0DUE2 c-di-GMP synthase 4.93e-05 2.02e-06 NA
2. P Q5ZL95 Terminal nucleotidyltransferase 5C 5.77e-02 9.19e-09 NA
2. P A7SFB5 Cyclic GMP-AMP synthase 1.04e-10 2.90e-03 NA
2. P B0BNK8 Terminal nucleotidyltransferase 5B 8.48e-02 6.91e-06 NA
2. P P0DTF0 Cyclic GMP-AMP synthase 7.67e-04 7.46e-17 NA