Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q8C088
(EGF-like and EMI domain-containing protein 1) with a FATCAT P-Value: 0.000646 and RMSD of 1.65 angstrom. The sequence alignment identity is 11.0%.
Structural alignment shown in left. Query protein Q0D2K5 colored as red in alignment, homolog Q8C088 colored as blue.
Query protein Q0D2K5 is also shown in right top, homolog Q8C088 showed in right bottom. They are colored based on secondary structures.
Q0D2K5 ---------------------------------------------------------------------------------------------------- 0 Q8C088 MTSPLCFWCFCVWAAANWPPGSALQLQPGMPNVCREEQLTLVRLSRPCAQAFIDTIQFWKQGCSGPRWCVGYERRIRYYIIYRHVYATEHQTVFRCCPGW 100 Q0D2K5 ---------------------------------------------------------------------------------------------------- 0 Q8C088 IQWDDEPGCFSSLSSLGTHFSGRECSYQDTRQCLCSQGFHGPHCQYEKNKHLESELTPGFLQKNVDECAVVNGGCQQRCINTLGTFHCECDTGYRRHADE 200 Q0D2K5 ---------------------------------------------------------------------------------------------------- 0 Q8C088 RTCIKTDPCAGANGCAHLCQTENGMARCACHAGYQLSEDKKACEDINECAGELAPCAHHCVNSKGSFTCTCHPGFELGADRKHCYRIELEIVNICEKNNG 300 Q0D2K5 ---------------------------------------------------------------------------------------------------- 0 Q8C088 GCSHHCEPAIGGAHCSCNHGHQLDTDGKTCIDFDECESGEACCAQLCINYLGGYECSCEEGFQISSDGCGCDALDEQLEEEEEEIDILRFPGRLAQNPPQ 400 Q0D2K5 -------------------------------MDELRWYHITVCLDHIFGHNCSLSCKDCMNGGKCQEGKSECSC-----------------------PAG 46 Q8C088 PFPYLDPSLTASYEDEDNDDADSEAEGEVQGLTAL--YRV-VCLDGTFGLDCSLSCEDCMNGGRCQEGKSGCLCPAEWTGLICNESSVLRTGEDQQAPAG 497 Q0D2K5 C----------------------RVI------L------CNENCLEGAYGAGCTSECQCVEENTLECSAKNGSCTCKSGYQGNRCQKDGLWGPEGWFSSA 112 Q8C088 CLKGFFGKNCKRKCHCANNVHCHRVYGACMCDLGRYGRFCHLSCPRGAYGASCSLECQCVEENTLECSAKNGSCTCKSGYQGNRCQEE-LPLPA------ 590 Q0D2K5 PCENGGQCNKKTGNCDCTPDYTRKSCTILRCISLTNLALSRRSSPMKYQQNVSSHREVRQRQQCSSDRPFKKLLCKFSFKIGM 195 Q8C088 ----------------------------------------------------------------------------------- 590
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005044 | scavenger receptor activity |
| 1. PB | GO:0030666 | endocytic vesicle membrane |
| 1. PB | GO:0006898 | receptor-mediated endocytosis |
| 1. PB | GO:0030169 | low-density lipoprotein particle binding |
| 1. PB | GO:0016322 | neuron remodeling |
| 1. PB | GO:0016055 | Wnt signaling pathway |
| 1. PB | GO:0007157 | heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules |
| 1. PB | GO:0009986 | cell surface |
| 1. PB | GO:0048680 | positive regulation of axon regeneration |
| 1. PB | GO:0030514 | negative regulation of BMP signaling pathway |
| 1. PB | GO:0005925 | focal adhesion |
| 1. PB | GO:0001709 | cell fate determination |
| 1. PB | GO:0035116 | embryonic hindlimb morphogenesis |
| 1. PB | GO:0004888 | transmembrane signaling receptor activity |
| 2. P | GO:0030177 | positive regulation of Wnt signaling pathway |
| 2. P | GO:0001654 | eye development |
| 2. P | GO:0006707 | cholesterol catabolic process |
| 2. P | GO:0016358 | dendrite development |
| 2. P | GO:0035878 | nail development |
| 2. P | GO:0060437 | lung growth |
| 2. P | GO:0005102 | signaling receptor binding |
| 2. P | GO:0005185 | neurohypophyseal hormone activity |
| 2. P | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 2. P | GO:0071542 | dopaminergic neuron differentiation |
| 2. P | GO:0001503 | ossification |
| 2. P | GO:0005576 | extracellular region |
| 2. P | GO:0035115 | embryonic forelimb morphogenesis |
| 2. P | GO:0001649 | osteoblast differentiation |
| 2. P | GO:0008201 | heparin binding |
| 2. P | GO:0042489 | negative regulation of odontogenesis of dentin-containing tooth |
| 2. P | GO:0060173 | limb development |
| 2. P | GO:0060535 | trachea cartilage morphogenesis |
| 2. P | GO:0030282 | bone mineralization |
| 2. P | GO:0042310 | vasoconstriction |
| 2. P | GO:0060441 | epithelial tube branching involved in lung morphogenesis |
| 2. P | GO:0010976 | positive regulation of neuron projection development |
| 2. P | GO:0030182 | neuron differentiation |
| 3. B | GO:0001708 | cell fate specification |
| 3. B | GO:0045766 | positive regulation of angiogenesis |
| 3. B | GO:1903356 | positive regulation of distal tip cell migration |
| 3. B | GO:0001570 | vasculogenesis |
| 3. B | GO:0043652 | engulfment of apoptotic cell |
| 3. B | GO:0003222 | ventricular trabecula myocardium morphogenesis |
| 3. B | GO:0030326 | embryonic limb morphogenesis |
| 3. B | GO:0060740 | prostate gland epithelium morphogenesis |
| 3. B | GO:0060411 | cardiac septum morphogenesis |
| 3. B | GO:0045571 | negative regulation of imaginal disc growth |
| 3. B | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 3. B | GO:0007169 | transmembrane receptor protein tyrosine kinase signaling pathway |
| 3. B | GO:0048337 | positive regulation of mesodermal cell fate specification |
| 3. B | GO:0009888 | tissue development |
| 3. B | GO:0048709 | oligodendrocyte differentiation |
| 3. B | GO:0045967 | negative regulation of growth rate |
| 3. B | GO:0003215 | cardiac right ventricle morphogenesis |
| 3. B | GO:0005201 | extracellular matrix structural constituent |
| 3. B | GO:0043011 | myeloid dendritic cell differentiation |
| 3. B | GO:0061331 | epithelial cell proliferation involved in Malpighian tubule morphogenesis |
| 3. B | GO:0005796 | Golgi lumen |
| 3. B | GO:0030901 | midbrain development |
| 3. B | GO:0035148 | tube formation |
| 3. B | GO:0043083 | synaptic cleft |
| 3. B | GO:0007507 | heart development |
| 3. B | GO:0045639 | positive regulation of myeloid cell differentiation |
| 3. B | GO:0001701 | in utero embryonic development |
| 3. B | GO:0072104 | glomerular capillary formation |
| 3. B | GO:0045605 | negative regulation of epidermal cell differentiation |
| 3. B | GO:0043259 | laminin-10 complex |
| 3. B | GO:0051059 | NF-kappaB binding |
| 3. B | GO:0030334 | regulation of cell migration |
| 3. B | GO:0001756 | somitogenesis |
| 3. B | GO:0060412 | ventricular septum morphogenesis |
| 3. B | GO:0003270 | Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation |
| 3. B | GO:0010812 | negative regulation of cell-substrate adhesion |
| 3. B | GO:0072006 | nephron development |
| 3. B | GO:0001935 | endothelial cell proliferation |
| 3. B | GO:0021514 | ventral spinal cord interneuron differentiation |
| 3. B | GO:0010631 | epithelial cell migration |
| 3. B | GO:0070986 | left/right axis specification |
| 3. B | GO:0043552 | positive regulation of phosphatidylinositol 3-kinase activity |
| 3. B | GO:0003252 | negative regulation of cell proliferation involved in heart valve morphogenesis |
| 3. B | GO:0006959 | humoral immune response |
| 3. B | GO:0021915 | neural tube development |
| 3. B | GO:0042127 | regulation of cell population proliferation |
| 3. B | GO:0043403 | skeletal muscle tissue regeneration |
| 3. B | GO:0061074 | regulation of neural retina development |
| 3. B | GO:0004930 | G protein-coupled receptor activity |
| 3. B | GO:0001837 | epithelial to mesenchymal transition |
| 3. B | GO:0048190 | wing disc dorsal/ventral pattern formation |
| 3. B | GO:0007521 | muscle cell fate determination |
| 3. B | GO:0045070 | positive regulation of viral genome replication |
| 3. B | GO:0048259 | regulation of receptor-mediated endocytosis |
| 3. B | GO:0061156 | pulmonary artery morphogenesis |
| 3. B | GO:0001569 | branching involved in blood vessel morphogenesis |
| 3. B | GO:0005610 | laminin-5 complex |
| 3. B | GO:0007446 | imaginal disc growth |
| 3. B | GO:0045176 | apical protein localization |
| 3. B | GO:0035264 | multicellular organism growth |
| 3. B | GO:0021536 | diencephalon development |
| 3. B | GO:0009887 | animal organ morphogenesis |
| 3. B | GO:0035622 | intrahepatic bile duct development |
| 3. B | GO:0007267 | cell-cell signaling |
| 3. B | GO:0061419 | positive regulation of transcription from RNA polymerase II promoter in response to hypoxia |
| 3. B | GO:0007221 | positive regulation of transcription of Notch receptor target |
| 3. B | GO:0045669 | positive regulation of osteoblast differentiation |
| 3. B | GO:0030336 | negative regulation of cell migration |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0042686 | regulation of cardioblast cell fate specification |
| 3. B | GO:0016324 | apical plasma membrane |
| 3. B | GO:0072307 | regulation of metanephric nephron tubule epithelial cell differentiation |
| 3. B | GO:0060571 | morphogenesis of an epithelial fold |
| 3. B | GO:0001657 | ureteric bud development |
| 3. B | GO:0030097 | hemopoiesis |
| 3. B | GO:0003162 | atrioventricular node development |
| 3. B | GO:0030324 | lung development |
| 3. B | GO:0061309 | cardiac neural crest cell development involved in outflow tract morphogenesis |
| 3. B | GO:0007492 | endoderm development |
| 3. B | GO:2001204 | regulation of osteoclast development |
| 3. B | GO:0007417 | central nervous system development |
| 3. B | GO:0014719 | skeletal muscle satellite cell activation |
| 3. B | GO:0031069 | hair follicle morphogenesis |
| 3. B | GO:0098858 | actin-based cell projection |
| 3. B | GO:0035214 | eye-antennal disc development |
| 3. B | GO:0061073 | ciliary body morphogenesis |
| 3. B | GO:2000251 | positive regulation of actin cytoskeleton reorganization |
| 3. B | GO:0003151 | outflow tract morphogenesis |
| 3. B | GO:0022409 | positive regulation of cell-cell adhesion |
| 3. B | GO:0010614 | negative regulation of cardiac muscle hypertrophy |
| 3. B | GO:0014068 | positive regulation of phosphatidylinositol 3-kinase signaling |
| 3. B | GO:0031017 | exocrine pancreas development |
| 3. B | GO:0072014 | proximal tubule development |
| 3. B | GO:0002437 | inflammatory response to antigenic stimulus |
| 3. B | GO:0048844 | artery morphogenesis |
| 3. B | GO:0045026 | plasma membrane fusion |
| 3. B | GO:0016339 | calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules |
| 3. B | GO:0002052 | positive regulation of neuroblast proliferation |
| 3. B | GO:0062043 | positive regulation of cardiac epithelial to mesenchymal transition |
| 3. B | GO:0016336 | establishment or maintenance of polarity of larval imaginal disc epithelium |
| 3. B | GO:0060071 | Wnt signaling pathway, planar cell polarity pathway |
| 3. B | GO:0045316 | negative regulation of compound eye photoreceptor development |
| 3. B | GO:0045607 | regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0042691 | positive regulation of crystal cell differentiation |
| 3. B | GO:0043506 | regulation of JUN kinase activity |
| 3. B | GO:0004713 | protein tyrosine kinase activity |
| 3. B | GO:0048715 | negative regulation of oligodendrocyte differentiation |
| 3. B | GO:0042688 | crystal cell differentiation |
| 3. B | GO:0048839 | inner ear development |
| 3. B | GO:0005509 | calcium ion binding |
| 3. B | GO:2000048 | negative regulation of cell-cell adhesion mediated by cadherin |
| 3. B | GO:0055001 | muscle cell development |
| 3. B | GO:0048631 | regulation of skeletal muscle tissue growth |
| 3. B | GO:1990433 | CSL-Notch-Mastermind transcription factor complex |
| 3. B | GO:0060979 | vasculogenesis involved in coronary vascular morphogenesis |
| 3. B | GO:0007160 | cell-matrix adhesion |
| 3. B | GO:0045662 | negative regulation of myoblast differentiation |
| 3. B | GO:0060853 | Notch signaling pathway involved in arterial endothelial cell fate commitment |
| 3. B | GO:0002051 | osteoblast fate commitment |
| 3. B | GO:0060269 | centripetally migrating follicle cell migration |
| 3. B | GO:0072017 | distal tubule development |
| 3. B | GO:0048056 | R3/R4 cell differentiation |
| 3. B | GO:0007440 | foregut morphogenesis |
| 3. B | GO:0003160 | endocardium morphogenesis |
| 3. B | GO:0048711 | positive regulation of astrocyte differentiation |
| 3. B | GO:0001757 | somite specification |
| 3. B | GO:0060490 | lateral sprouting involved in lung morphogenesis |
| 3. B | GO:0014816 | skeletal muscle satellite cell differentiation |
| 3. B | GO:0072554 | blood vessel lumenization |
| 3. B | GO:0007476 | imaginal disc-derived wing morphogenesis |
| 3. B | GO:0007386 | compartment pattern specification |
| 3. B | GO:0009925 | basal plasma membrane |
| 3. B | GO:0043086 | negative regulation of catalytic activity |
| 3. B | GO:0060579 | ventral spinal cord interneuron fate commitment |
| 3. B | GO:0060488 | orthogonal dichotomous subdivision of terminal units involved in lung branching morphogenesis |
| 3. B | GO:0009608 | response to symbiont |
| 3. B | GO:0016330 | second mitotic wave involved in compound eye morphogenesis |
| 3. B | GO:0036514 | dopaminergic neuron axon guidance |
| 3. B | GO:0003181 | atrioventricular valve morphogenesis |
| 3. B | GO:0031589 | cell-substrate adhesion |
| 3. B | GO:0090051 | negative regulation of cell migration involved in sprouting angiogenesis |
| 3. B | GO:0042663 | regulation of endodermal cell fate specification |
| 3. B | GO:1902742 | apoptotic process involved in development |
| 3. B | GO:0001947 | heart looping |
| 3. B | GO:0007478 | leg disc morphogenesis |
| 3. B | GO:0060768 | regulation of epithelial cell proliferation involved in prostate gland development |
| 3. B | GO:2000811 | negative regulation of anoikis |
| 3. B | GO:0070374 | positive regulation of ERK1 and ERK2 cascade |
| 3. B | GO:0050679 | positive regulation of epithelial cell proliferation |
| 3. B | GO:0008593 | regulation of Notch signaling pathway |
| 3. B | GO:0016348 | imaginal disc-derived leg joint morphogenesis |
| 3. B | GO:0001840 | neural plate development |
| 3. B | GO:0045608 | negative regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0031012 | extracellular matrix |
| 3. B | GO:0055008 | cardiac muscle tissue morphogenesis |
| 3. B | GO:0072574 | hepatocyte proliferation |
| 3. B | GO:0010629 | negative regulation of gene expression |
| 3. B | GO:0022008 | neurogenesis |
| 3. B | GO:0003197 | endocardial cushion development |
| 3. B | GO:0007164 | establishment of tissue polarity |
| 3. B | GO:0001953 | negative regulation of cell-matrix adhesion |
| 3. B | GO:0072044 | collecting duct development |
| 3. B | GO:0001891 | phagocytic cup |
| 3. B | GO:0001890 | placenta development |
| 3. B | GO:0003203 | endocardial cushion morphogenesis |
| 3. B | GO:0007498 | mesoderm development |
| 3. B | GO:0060872 | semicircular canal development |
| 3. B | GO:0045603 | positive regulation of endothelial cell differentiation |
| 3. B | GO:0032526 | response to retinoic acid |
| 3. B | GO:0001974 | blood vessel remodeling |
| 3. B | GO:0001764 | neuron migration |
| 3. B | GO:0045746 | negative regulation of Notch signaling pathway |
| 3. B | GO:0030155 | regulation of cell adhesion |
| 3. B | GO:0033165 | interphotoreceptor matrix |
| 3. B | GO:0003184 | pulmonary valve morphogenesis |
| 3. B | GO:0003169 | coronary vein morphogenesis |
| 3. B | GO:0045317 | equator specification |
| 3. B | GO:0046427 | positive regulation of receptor signaling pathway via JAK-STAT |
| 3. B | GO:0043410 | positive regulation of MAPK cascade |
| 3. B | GO:0055016 | hypochord development |
| 3. B | GO:0060528 | secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development |
| 3. B | GO:0045665 | negative regulation of neuron differentiation |
| 3. B | GO:0002315 | marginal zone B cell differentiation |
| 3. B | GO:0031016 | pancreas development |
| 3. B | GO:0010832 | negative regulation of myotube differentiation |
| 3. B | GO:0007295 | growth of a germarium-derived egg chamber |
| 3. B | GO:0071372 | cellular response to follicle-stimulating hormone stimulus |
| 3. B | GO:0022408 | negative regulation of cell-cell adhesion |
| 3. B | GO:0021591 | ventricular system development |
| 3. B | GO:0045747 | positive regulation of Notch signaling pathway |
| 3. B | GO:0035924 | cellular response to vascular endothelial growth factor stimulus |
| 3. B | GO:0032495 | response to muramyl dipeptide |
| 3. B | GO:0007368 | determination of left/right symmetry |
| 3. B | GO:0098609 | cell-cell adhesion |
| 3. B | GO:0060982 | coronary artery morphogenesis |
| 3. B | GO:0045687 | positive regulation of glial cell differentiation |
| 3. B | GO:0007413 | axonal fasciculation |
| 3. B | GO:0051726 | regulation of cell cycle |
| 3. B | GO:0001845 | phagolysosome assembly |
| 3. B | GO:0016360 | sensory organ precursor cell fate determination |
| 3. B | GO:0042060 | wound healing |
| 3. B | GO:0097102 | endothelial tip cell fate specification |
| 3. B | GO:0030720 | oocyte localization involved in germarium-derived egg chamber formation |
| 3. B | GO:0050768 | negative regulation of neurogenesis |
| 3. B | GO:0036515 | serotonergic neuron axon guidance |
| 3. B | GO:0019838 | growth factor binding |
| 3. B | GO:0060854 | branching involved in lymph vessel morphogenesis |
| 3. B | GO:0046666 | retinal cell programmed cell death |
| 3. B | GO:0010838 | positive regulation of keratinocyte proliferation |
| 3. B | GO:2000171 | negative regulation of dendrite development |
| 3. B | GO:0061444 | endocardial cushion cell development |
| 3. B | GO:0048103 | somatic stem cell division |
| 3. B | GO:0051147 | regulation of muscle cell differentiation |
| 3. B | GO:0060843 | venous endothelial cell differentiation |
| 3. B | GO:0005902 | microvillus |
| 3. B | GO:0048873 | homeostasis of number of cells within a tissue |
| 3. B | GO:0014065 | phosphatidylinositol 3-kinase signaling |
| 3. B | GO:0045177 | apical part of cell |
| 3. B | GO:0021515 | cell differentiation in spinal cord |
| 3. B | GO:0007156 | homophilic cell adhesion via plasma membrane adhesion molecules |
| 3. B | GO:0003207 | cardiac chamber formation |
| 3. B | GO:0061384 | heart trabecula morphogenesis |
| 3. B | GO:1904396 | regulation of neuromuscular junction development |
| 3. B | GO:0060836 | lymphatic endothelial cell differentiation |
| 3. B | GO:0002011 | morphogenesis of an epithelial sheet |
| 3. B | GO:1902463 | protein localization to cell leading edge |
| 3. B | GO:0043260 | laminin-11 complex |
| 3. B | GO:0001738 | morphogenesis of a polarized epithelium |
| 3. B | GO:0072015 | glomerular visceral epithelial cell development |
| 3. B | GO:0014807 | regulation of somitogenesis |
| 3. B | GO:0030279 | negative regulation of ossification |
| 3. B | GO:0048663 | neuron fate commitment |
| 3. B | GO:0048633 | positive regulation of skeletal muscle tissue growth |
| 3. B | GO:0003182 | coronary sinus valve morphogenesis |
| 3. B | GO:1901863 | positive regulation of muscle tissue development |
| 3. B | GO:1902339 | positive regulation of apoptotic process involved in morphogenesis |
| 3. B | GO:0003412 | establishment of epithelial cell apical/basal polarity involved in camera-type eye morphogenesis |
| 3. B | GO:0018108 | peptidyl-tyrosine phosphorylation |
| 3. B | GO:0034451 | centriolar satellite |
| 3. B | GO:0031254 | cell trailing edge |
| 3. B | GO:0003209 | cardiac atrium morphogenesis |
| 3. B | GO:0048052 | R1/R6 cell differentiation |
| 3. B | GO:0031490 | chromatin DNA binding |
| 3. B | GO:0033326 | cerebrospinal fluid secretion |
| 3. B | GO:0021531 | spinal cord radial glial cell differentiation |
| 3. B | GO:0050678 | regulation of epithelial cell proliferation |
| 3. B | GO:0005911 | cell-cell junction |
| 3. B | GO:0001737 | establishment of imaginal disc-derived wing hair orientation |
| 3. B | GO:0005540 | hyaluronic acid binding |
| 3. B | GO:0043654 | recognition of apoptotic cell |
| 3. B | GO:0045995 | regulation of embryonic development |
| 3. B | GO:0032878 | regulation of establishment or maintenance of cell polarity |
| 3. B | GO:0042247 | establishment of planar polarity of follicular epithelium |
| 3. B | GO:0048105 | establishment of body hair planar orientation |
| 3. B | GO:0072576 | liver morphogenesis |
| 3. B | GO:0007517 | muscle organ development |
| 3. B | GO:0048627 | myoblast development |
| 3. B | GO:0045602 | negative regulation of endothelial cell differentiation |
| 3. B | GO:0003213 | cardiac right atrium morphogenesis |
| 3. B | GO:0061382 | Malpighian tubule tip cell differentiation |
| 3. B | GO:0050793 | regulation of developmental process |
| 3. B | GO:1902263 | apoptotic process involved in embryonic digit morphogenesis |
| 3. B | GO:0035172 | hemocyte proliferation |
| 3. B | GO:0003344 | pericardium morphogenesis |
| 3. B | GO:0009912 | auditory receptor cell fate commitment |
| 3. B | GO:0046849 | bone remodeling |
| 3. B | GO:0001942 | hair follicle development |
| 3. B | GO:2000249 | regulation of actin cytoskeleton reorganization |
| 3. B | GO:0003208 | cardiac ventricle morphogenesis |
| 3. B | GO:0003214 | cardiac left ventricle morphogenesis |
| 3. B | GO:0010595 | positive regulation of endothelial cell migration |
| 3. B | GO:2000351 | regulation of endothelial cell apoptotic process |
| 3. B | GO:0002244 | hematopoietic progenitor cell differentiation |
| 3. B | GO:0072070 | loop of Henle development |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0098773 | skin epidermis development |
| 3. B | GO:0045184 | establishment of protein localization |
| 3. B | GO:0035204 | negative regulation of lamellocyte differentiation |
| 3. B | GO:0016323 | basolateral plasma membrane |
| 3. B | GO:0008037 | cell recognition |
| 3. B | GO:0001750 | photoreceptor outer segment |
| 3. B | GO:0035153 | epithelial cell type specification, open tracheal system |
| 3. B | GO:0046331 | lateral inhibition |
| 3. B | GO:0003341 | cilium movement |
| 3. B | GO:0007297 | ovarian follicle cell migration |
| 3. B | GO:0021688 | cerebellar molecular layer formation |
| 3. B | GO:0003219 | cardiac right ventricle formation |
| 3. B | GO:0032880 | regulation of protein localization |
| 3. B | GO:0034109 | homotypic cell-cell adhesion |
| 3. B | GO:0007219 | Notch signaling pathway |
| 3. B | GO:0043235 | receptor complex |
| 3. B | GO:0001658 | branching involved in ureteric bud morphogenesis |
| 3. B | GO:0072144 | glomerular mesangial cell development |
| 3. B | GO:0001501 | skeletal system development |
| 3. B | GO:0051451 | myoblast migration |
| 3. B | GO:0038023 | signaling receptor activity |
| 3. B | GO:0060956 | endocardial cell differentiation |
| 3. B | GO:0060354 | negative regulation of cell adhesion molecule production |
| 3. B | GO:0030878 | thyroid gland development |
| 3. B | GO:0042491 | inner ear auditory receptor cell differentiation |
| 3. B | GO:0060218 | hematopoietic stem cell differentiation |
| 3. B | GO:0048771 | tissue remodeling |
| 3. B | GO:0007447 | imaginal disc pattern formation |
| 3. B | GO:1901189 | positive regulation of ephrin receptor signaling pathway |
| 3. B | GO:0097376 | interneuron axon guidance |
| 3. B | GO:0033002 | muscle cell proliferation |
| 3. B | GO:0021523 | somatic motor neuron differentiation |
| 3. B | GO:0003332 | negative regulation of extracellular matrix constituent secretion |
| 3. B | GO:0005041 | low-density lipoprotein particle receptor activity |
| 3. B | GO:0060038 | cardiac muscle cell proliferation |
| 3. B | GO:0072137 | condensed mesenchymal cell proliferation |
| 3. B | GO:0031260 | pseudopodium membrane |
| 3. B | GO:0002040 | sprouting angiogenesis |
| 3. B | GO:0051897 | positive regulation of protein kinase B signaling |
| 3. B | GO:0120163 | negative regulation of cold-induced thermogenesis |
| 3. B | GO:0045165 | cell fate commitment |
| 3. B | GO:0045596 | negative regulation of cell differentiation |
| 3. B | GO:0005912 | adherens junction |
| 3. B | GO:0035914 | skeletal muscle cell differentiation |
| 3. B | GO:0060288 | formation of a compartment boundary |
| 3. B | GO:0001936 | regulation of endothelial cell proliferation |
| 3. B | GO:0008347 | glial cell migration |
| 3. B | GO:0045618 | positive regulation of keratinocyte differentiation |
| 3. B | GO:2000288 | positive regulation of myoblast proliferation |
| 3. B | GO:0003180 | aortic valve morphogenesis |
| 3. B | GO:2000352 | negative regulation of endothelial cell apoptotic process |
| 3. B | GO:1990705 | cholangiocyte proliferation |
| 3. B | GO:0045570 | regulation of imaginal disc growth |
| 3. B | GO:0007411 | axon guidance |
| 3. B | GO:0098633 | collagen fibril binding |
| 3. B | GO:0042246 | tissue regeneration |
| 3. B | GO:0003157 | endocardium development |
| 3. B | GO:0021693 | cerebellar Purkinje cell layer structural organization |
| 3. B | GO:1902533 | positive regulation of intracellular signal transduction |
| 3. B | GO:0000904 | cell morphogenesis involved in differentiation |
| 3. B | GO:0045672 | positive regulation of osteoclast differentiation |
| 3. B | GO:1904747 | positive regulation of apoptotic process involved in development |
| 3. B | GO:0030216 | keratinocyte differentiation |
| 3. B | GO:0003241 | growth involved in heart morphogenesis |
| 3. B | GO:0097150 | neuronal stem cell population maintenance |
| 3. B | GO:0046533 | negative regulation of photoreceptor cell differentiation |
| 3. B | GO:0072534 | perineuronal net |
| 3. B | GO:0001849 | complement component C1q complex binding |
| 3. B | GO:0060045 | positive regulation of cardiac muscle cell proliferation |
| 3. B | GO:0060289 | compartment boundary maintenance |
| 3. B | GO:0045668 | negative regulation of osteoblast differentiation |
| 3. B | GO:0035071 | salivary gland cell autophagic cell death |
| 3. B | GO:0072012 | glomerulus vasculature development |
| 3. B | GO:0035171 | lamellocyte differentiation |
| 3. B | GO:0005112 | Notch binding |
| 3. B | GO:0003198 | epithelial to mesenchymal transition involved in endocardial cushion formation |
| 3. B | GO:1903849 | positive regulation of aorta morphogenesis |
| 3. B | GO:0060347 | heart trabecula formation |
| 3. B | GO:0060034 | notochord cell differentiation |
| 3. B | GO:0048641 | regulation of skeletal muscle tissue development |
| 3. B | GO:0010378 | temperature compensation of the circadian clock |
| 3. B | GO:0050908 | detection of light stimulus involved in visual perception |
| 3. B | GO:0001889 | liver development |
| 3. B | GO:0008285 | negative regulation of cell population proliferation |
| 3. B | GO:0060413 | atrial septum morphogenesis |
| 3. B | GO:0035329 | hippo signaling |
| 3. B | GO:0003192 | mitral valve formation |
| 3. B | GO:0048014 | Tie signaling pathway |
| 3. B | GO:0003140 | determination of left/right asymmetry in lateral mesoderm |
| 3. B | GO:0060674 | placenta blood vessel development |
| 3. B | GO:0043065 | positive regulation of apoptotic process |
| 3. B | GO:0048630 | skeletal muscle tissue growth |
| 3. B | GO:0001736 | establishment of planar polarity |
| 3. B | GO:0048665 | neuron fate specification |
| 3. B | GO:0060317 | cardiac epithelial to mesenchymal transition |
| 3. B | GO:0036011 | imaginal disc-derived leg segmentation |
| 3. B | GO:0035909 | aorta morphogenesis |
| 3. B | GO:0003264 | regulation of cardioblast proliferation |
| 3. B | GO:0046667 | compound eye retinal cell programmed cell death |
| 3. B | GO:0061314 | Notch signaling involved in heart development |
| 3. B | GO:0060948 | cardiac vascular smooth muscle cell development |
| 3. B | GO:0035469 | determination of pancreatic left/right asymmetry |
| 3. B | GO:0033674 | positive regulation of kinase activity |
| 3. B | GO:0007403 | glial cell fate determination |
| 3. B | GO:0034446 | substrate adhesion-dependent cell spreading |
| 3. B | GO:0021999 | neural plate anterior/posterior regionalization |
| 3. B | GO:0035907 | dorsal aorta development |
| 3. B | GO:0050767 | regulation of neurogenesis |
| 3. B | GO:0007155 | cell adhesion |
| 3. B | GO:0002456 | T cell mediated immunity |
| 3. B | GO:0019899 | enzyme binding |
| 3. B | GO:0022407 | regulation of cell-cell adhesion |
| 3. B | GO:0090176 | microtubule cytoskeleton organization involved in establishment of planar polarity |
| 3. B | GO:0031100 | animal organ regeneration |
| 3. B | GO:0070527 | platelet aggregation |
| 3. B | GO:0060445 | branching involved in salivary gland morphogenesis |
| 3. B | GO:0045466 | R7 cell differentiation |
| 3. B | GO:0001525 | angiogenesis |
| 3. B | GO:0004857 | enzyme inhibitor activity |
| 3. B | GO:1904938 | planar cell polarity pathway involved in axon guidance |
| 3. B | GO:2000974 | negative regulation of pro-B cell differentiation |
| 3. B | GO:0060842 | arterial endothelial cell differentiation |
| 3. B | GO:0043277 | apoptotic cell clearance |
| 3. B | GO:0048845 | venous blood vessel morphogenesis |
| 3. B | GO:0051894 | positive regulation of focal adhesion assembly |
| 3. B | GO:0014841 | skeletal muscle satellite cell proliferation |
| 3. B | GO:2000726 | negative regulation of cardiac muscle cell differentiation |
| 3. B | GO:0045955 | negative regulation of calcium ion-dependent exocytosis |
| 3. B | GO:2001027 | negative regulation of endothelial cell chemotaxis |
| 3. B | GO:0030713 | ovarian follicle cell stalk formation |
| 3. B | GO:0060489 | planar dichotomous subdivision of terminal units involved in lung branching morphogenesis |
| 3. B | GO:0016331 | morphogenesis of embryonic epithelium |
| 3. B | GO:0060253 | negative regulation of glial cell proliferation |
| 3. B | GO:0042067 | establishment of ommatidial planar polarity |
| 3. B | GO:0002193 | MAML1-RBP-Jkappa- ICN1 complex |
| 3. B | GO:0060271 | cilium assembly |
| 3. B | GO:0046579 | positive regulation of Ras protein signal transduction |
| 3. B | GO:0008284 | positive regulation of cell population proliferation |
| 3. B | GO:0030513 | positive regulation of BMP signaling pathway |
| 3. B | GO:0044331 | cell-cell adhesion mediated by cadherin |
| 3. B | GO:0010628 | positive regulation of gene expression |
| 3. B | GO:2000737 | negative regulation of stem cell differentiation |
| 3. B | GO:0014031 | mesenchymal cell development |
| 3. B | GO:0016525 | negative regulation of angiogenesis |
| 3. B | GO:0048754 | branching morphogenesis of an epithelial tube |
| 3. B | GO:0061056 | sclerotome development |
| 3. B | GO:0045599 | negative regulation of fat cell differentiation |
| 3. B | GO:0001669 | acrosomal vesicle |
| 3. B | GO:0010001 | glial cell differentiation |
| 3. B | GO:0004714 | transmembrane receptor protein tyrosine kinase activity |
| 3. B | GO:0062023 | collagen-containing extracellular matrix |
| 3. B | GO:0035209 | pupal development |
| 3. B | GO:0031960 | response to corticosteroid |
| 3. B | GO:0042249 | establishment of planar polarity of embryonic epithelium |
| 3. B | GO:0003256 | regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation |
| 3. B | GO:1901201 | regulation of extracellular matrix assembly |
| 3. B | GO:0042742 | defense response to bacterium |
| 3. B | GO:0010842 | retina layer formation |
| 3. B | GO:0030900 | forebrain development |
| 3. B | GO:0003273 | cell migration involved in endocardial cushion formation |
| 3. B | GO:0050434 | positive regulation of viral transcription |
| 3. B | GO:0090251 | protein localization involved in establishment of planar polarity |
| 3. B | GO:0070168 | negative regulation of biomineral tissue development |
| 3. B | GO:0032474 | otolith morphogenesis |
| 3. B | GO:0061344 | regulation of cell adhesion involved in heart morphogenesis |
| 3. B | GO:0048708 | astrocyte differentiation |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q0D2K5 | Putative EGF-like and EMI domain-containing protein 1 | 0 | 6.78e-169 | 6.27e-143 |
| 1. PB | Q96GP6 | Scavenger receptor class F member 2 | 6.54e-02 | 3.37e-03 | 3.93e-06 |
| 1. PB | Q14162 | Scavenger receptor class F member 1 | 6.68e-02 | 8.94e-04 | 8.74e-05 |
| 2. P | P10769 | Vasopressin-neurophysin 2-copeptin | 7.41e-01 | 1.46e-04 | NA |
| 2. P | Q8BFU0 | R-spondin-2 | 5.85e-01 | 2.00e-03 | NA |
| 2. P | Q2I0M5 | R-spondin-4 | 5.75e-01 | 3.89e-04 | NA |
| 2. P | P01181 | Vasopressin-neurophysin 2-copeptin (Fragment) | NA | 1.70e-05 | NA |
| 2. P | Q6UXX9 | R-spondin-2 | 6.51e-01 | 1.29e-04 | NA |
| 2. P | Q8SW43 | Zinc finger C2H2 protein ECU03_0790 | 9.52e-01 | 3.73e-03 | NA |
| 2. P | Q76LD0 | Chordin-like protein 1 | 9.18e-01 | 1.95e-02 | NA |
| 3. B | Q9HCU4 | Cadherin EGF LAG seven-pass G-type receptor 2 | NA | NA | 3.36e-04 |
| 3. B | Q02763 | Angiopoietin-1 receptor | 4.19e-01 | NA | 1.49e-05 |
| 3. B | O73791 | Tyrosine-protein kinase receptor Tie-2 | 4.97e-01 | NA | 3.00e-08 |
| 3. B | Q9VW71 | Fat-like cadherin-related tumor suppressor homolog | NA | NA | 0.003 |
| 3. B | B8JI71 | Protein eyes shut homolog | NA | NA | 0.024 |
| 3. B | P13611 | Versican core protein | NA | NA | 0.022 |
| 3. B | Q5R6R1 | Protein eyes shut homolog | NA | NA | 0.002 |
| 3. B | Q54KF7 | Integrin beta-like protein A | 9.82e-01 | NA | 5.15e-04 |
| 3. B | Q54JA4 | Integrin beta-like protein D | 9.86e-01 | NA | 0.042 |
| 3. B | Q2PZL6 | Protocadherin Fat 4 | NA | NA | 2.23e-04 |
| 3. B | Q9NL29 | Abnormal pharyngeal pumping eat-20 | 3.42e-01 | NA | 6.42e-04 |
| 3. B | Q61982 | Neurogenic locus notch homolog protein 3 | 9.26e-01 | NA | 2.95e-06 |
| 3. B | Q14517 | Protocadherin Fat 1 | NA | NA | 1.59e-06 |
| 3. B | Q9NYQ7 | Cadherin EGF LAG seven-pass G-type receptor 3 | NA | NA | 4.14e-04 |
| 3. B | Q5VY43 | Platelet endothelial aggregation receptor 1 | 5.56e-02 | NA | 1.93e-10 |
| 3. B | Q19319 | Cadherin-4 | NA | NA | 0.040 |
| 3. B | P81282 | Versican core protein | NA | NA | 0.005 |
| 3. B | Q5ND28 | Scavenger receptor class F member 1 | 6.39e-02 | NA | 9.03e-06 |
| 3. B | O15230 | Laminin subunit alpha-5 | NA | NA | 0.030 |
| 3. B | A6BM72 | Multiple epidermal growth factor-like domains protein 11 | 1.91e-02 | NA | 1.47e-15 |
| 3. B | A0JM12 | Multiple epidermal growth factor-like domains protein 10 | 4.69e-02 | NA | 2.94e-16 |
| 3. B | Q9XWD6 | Cell death abnormality protein 1 | 4.07e-02 | NA | 1.24e-15 |
| 3. B | Q5T1H1 | Protein eyes shut homolog | NA | NA | 0.011 |
| 3. B | Q9UM47 | Neurogenic locus notch homolog protein 3 | 8.95e-01 | NA | 0.007 |
| 3. B | Q90Y54 | Protein jagged-1b | 5.72e-01 | NA | 0.004 |
| 3. B | Q8R508 | Protocadherin Fat 3 | NA | NA | 1.25e-05 |
| 3. B | A0A2K5V015 | Protein eyes shut homolog | NA | NA | 0.002 |
| 3. B | Q07008 | Neurogenic locus notch homolog protein 1 | 9.48e-01 | NA | 0.005 |
| 3. B | G5EDK5 | Cadherin EGF LAG seven-pass G-type receptor fmi-1 | 9.61e-01 | NA | 0.005 |
| 3. B | Q6IN38 | Wnt inhibitory factor 1 | 2.97e-02 | NA | 0.013 |
| 3. B | Q9ERB4 | Versican core protein (Fragments) | NA | NA | 0.019 |
| 3. B | Q8BNA6 | Protocadherin Fat 3 | NA | NA | 1.11e-05 |
| 3. B | Q04721 | Neurogenic locus notch homolog protein 2 | 8.84e-01 | NA | 0.002 |
| 3. B | Q9R172 | Neurogenic locus notch homolog protein 3 | 8.90e-01 | NA | 9.60e-06 |
| 3. B | Q9NYQ8 | Protocadherin Fat 2 | NA | NA | 3.99e-04 |
| 3. B | Q55AP8 | EGF-like domain-containing protein comC | 6.86e-01 | NA | 8.50e-04 |
| 3. B | Q9W6F8 | Wnt inhibitory factor 1 | 6.88e-02 | NA | 0.002 |
| 3. B | Q80V70 | Multiple epidermal growth factor-like domains protein 6 | 6.44e-02 | NA | 1.26e-18 |
| 3. B | O88278 | Cadherin EGF LAG seven-pass G-type receptor 3 | NA | NA | 4.14e-05 |
| 3. B | P46530 | Neurogenic locus notch homolog protein 1 | 9.02e-01 | NA | 3.31e-04 |
| 3. B | Q5ZQU0 | Sushi, nidogen and EGF-like domain-containing protein 1 | 6.79e-01 | NA | 0.006 |
| 3. B | O88281 | Multiple epidermal growth factor-like domains protein 6 | 4.35e-02 | NA | 3.14e-18 |
| 3. B | Q9NYQ6 | Cadherin EGF LAG seven-pass G-type receptor 1 | NA | NA | 0.003 |
| 3. B | Q9QW30 | Neurogenic locus notch homolog protein 2 | 9.41e-01 | NA | 0.006 |
| 3. B | Q62059 | Versican core protein | NA | NA | 0.018 |
| 3. B | P33450 | Cadherin-related tumor suppressor | NA | NA | 0.010 |
| 3. B | Q96KG7 | Multiple epidermal growth factor-like domains protein 10 | 3.55e-02 | NA | 2.79e-13 |
| 3. B | Q01705 | Neurogenic locus notch homolog protein 1 | 9.34e-01 | NA | 0.004 |
| 3. B | P59222 | Scavenger receptor class F member 2 | 5.76e-02 | NA | 1.63e-06 |
| 3. B | Q80T91 | Multiple epidermal growth factor-like domains protein 11 | 3.70e-02 | NA | 5.82e-17 |
| 3. B | Q6V0I7 | Protocadherin Fat 4 | NA | NA | 3.91e-06 |
| 3. B | P35590 | Tyrosine-protein kinase receptor Tie-1 | 3.72e-01 | NA | 2.70e-07 |
| 3. B | E9QJQ6 | Multiple epidermal growth factor-like domains protein 10 | 4.94e-02 | NA | 1.15e-13 |
| 3. B | P22105 | Tenascin-X | NA | NA | 2.98e-07 |
| 3. B | Q8R4Y4 | Stabilin-1 | 9.31e-01 | NA | 0.007 |
| 3. B | A8X481 | Abnormal pharyngeal pumping eat-20 | 5.76e-01 | NA | 0.005 |
| 3. B | Q06805 | Tyrosine-protein kinase receptor Tie-1 | 5.02e-01 | NA | 1.90e-07 |
| 3. B | O88277 | Protocadherin Fat 2 | NA | NA | 0.002 |
| 3. B | Q9W0A0 | Protein draper | 2.01e-02 | NA | 1.76e-14 |
| 3. B | Q8TER0 | Sushi, nidogen and EGF-like domain-containing protein 1 | 7.83e-01 | NA | 0.001 |
| 3. B | Q8UWJ4 | Delta-like protein D | 2.09e-01 | NA | 1.68e-04 |
| 3. B | P46531 | Neurogenic locus notch homolog protein 1 | 9.40e-01 | NA | 0.008 |
| 3. B | Q9WUA1 | Wnt inhibitory factor 1 | 7.42e-02 | NA | 0.014 |
| 3. B | Q9QXX0 | Protein jagged-1 | 4.50e-01 | NA | 0.002 |
| 3. B | Q6DIB5 | Multiple epidermal growth factor-like domains protein 10 | 6.07e-02 | NA | 4.94e-13 |
| 3. B | P21783 | Neurogenic locus notch homolog protein 1 | 9.48e-01 | NA | 0.005 |
| 3. B | Q9IAT6 | Delta-like protein C | 1.82e-01 | NA | 0.002 |
| 3. B | Q9NR61 | Delta-like protein 4 | 2.70e-01 | NA | 0.041 |
| 3. B | Q9NY15 | Stabilin-1 | 9.42e-01 | NA | 0.005 |
| 3. B | Q70E20 | Sushi, nidogen and EGF-like domain-containing protein 1 | 7.79e-01 | NA | 0.001 |
| 3. B | Q02858 | Angiopoietin-1 receptor | 4.35e-01 | NA | 1.01e-05 |
| 3. B | A2RUV0 | Neurogenic locus notch homolog protein 1 | 9.39e-01 | NA | 0.006 |
| 3. B | O35161 | Cadherin EGF LAG seven-pass G-type receptor 1 | NA | NA | 0.002 |
| 3. B | Q91ZI0 | Cadherin EGF LAG seven-pass G-type receptor 3 | NA | NA | 8.01e-05 |
| 3. B | O35516 | Neurogenic locus notch homolog protein 2 | 9.45e-01 | NA | 0.001 |
| 3. B | Q61001 | Laminin subunit alpha-5 | NA | NA | 0.011 |
| 3. B | Q5F226 | Protocadherin Fat 2 | NA | NA | 8.21e-04 |
| 3. B | Q6DI48 | Delta-like protein A | 2.73e-01 | NA | 8.90e-04 |
| 3. B | Q63722 | Protein jagged-1 | 5.78e-01 | NA | 0.002 |
| 3. B | Q8VIK5 | Platelet endothelial aggregation receptor 1 | 2.60e-02 | NA | 2.37e-11 |
| 3. B | Q90Y57 | Protein jagged-1a | 6.17e-01 | NA | 0.009 |
| 3. B | O57409 | Delta-like protein B | 1.56e-01 | NA | 0.033 |
| 3. B | P97677 | Delta-like protein 1 | 2.08e-01 | NA | 0.034 |
| 3. B | Q8R4U0 | Stabilin-2 | 9.36e-01 | NA | 0.002 |
| 3. B | Q06807 | Angiopoietin-1 receptor | 4.31e-01 | NA | 1.11e-05 |
| 3. B | P07207 | Neurogenic locus Notch protein | NA | NA | 0.022 |
| 3. B | O75095 | Multiple epidermal growth factor-like domains protein 6 | 5.56e-02 | NA | 1.70e-16 |
| 3. B | Q9R0M0 | Cadherin EGF LAG seven-pass G-type receptor 2 | NA | NA | 0.002 |
| 3. B | A8XMW6 | Cell death abnormality protein 1 | 3.62e-02 | NA | 1.26e-14 |
| 3. B | Q8C088 | EGF-like and EMI domain-containing protein 1 | 6.46e-04 | NA | 4.67e-26 |
| 3. B | A0A1F4 | Protein eyes shut | 9.10e-01 | NA | 0.032 |
| 3. B | Q06806 | Tyrosine-protein kinase receptor Tie-1 | 3.63e-01 | NA | 1.41e-06 |
| 3. B | P78504 | Protein jagged-1 | 6.00e-01 | NA | 0.002 |
| 3. B | G3I6Z6 | Neurogenic locus notch homolog protein 1 | NA | NA | 0.004 |