Summary

Q0P641

Homolog: Q8CC14.
Function: Protein FAM216B.

Statistics

Total GO Annotation: 10
Unique PROST Go: 10
Unique BLAST Go: 0

Total Homologs: 15
Unique PROST Homologs: 12
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q8CC14 (Protein FAM216B) with a FATCAT P-Value: 0.038 and RMSD of 3.31 angstrom. The sequence alignment identity is 20.0%.
Structural alignment shown in left. Query protein Q0P641 colored as red in alignment, homolog Q8CC14 colored as blue. Query protein Q0P641 is also shown in right top, homolog Q8CC14 showed in right bottom. They are colored based on secondary structures. 

  Q0P641 MERRLIKKEMKKLLGDYI-GI-RLR------ENEF--D-PKGRRQLTFL-DDMAHYDLAISVALQWLDPSEDLTWLEWEELKIP-LH--GRPIYPNR--- 82
  Q8CC14 ---------MWKDLPQNVPRIPRIQVPAAAADNSLLKDLNQGQR--CYLYSIMRIYD---S------RP-------QWKALQTRYIHSLG---YQQHLGY 70

  Q0P641 -REREAMILSSYAGIL----MN---SI-P----IEEVFKIYGADSSADSG-TIKVP--RVSSLCLSLHPFAML---TAPKAAAYARKQSVKSRKVTTNKN 163
  Q8CC14 ITQQEA--LSC-AAVLRHSTMRASATVAPQRTILPRVF------SHAKKGQPAK-PGFRVGSRA-SLH--SMLSTKTLDKA------------------- 138

  Q0P641 ATSISAKEANATEWKSSQRFSDTQPKHKVT 193
  Q8CC14 ------------------------------ 138

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0071005 U2-type precatalytic spliceosome
2. P GO:0019029 helical viral capsid
2. P GO:0016020 membrane
2. P GO:0009399 nitrogen fixation
2. P GO:0000398 mRNA splicing, via spliceosome
2. P GO:0030430 host cell cytoplasm
2. P GO:0005686 U2 snRNP
2. P GO:0019058 viral life cycle
2. P GO:0020002 host cell plasma membrane
2. P GO:0071011 precatalytic spliceosome

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q0P641 Uncharacterized protein C2orf80 0 5.47e-139 1.43e-143
1. PB Q8C3M9 Uncharacterized protein C2orf80 homolog 1.60e-05 3.59e-11 1.31e-85
1. PB Q5RDL5 Uncharacterized protein C2orf80 homolog 1.39e-04 1.99e-15 4.13e-105
2. P P93310 Uncharacterized mitochondrial protein AtMg00550 2.00e-01 1.77e-02 NA
2. P Q55BF5 Splicing factor 3B subunit 5 4.22e-02 3.66e-02 NA
2. P Q00247 Uncharacterized 15.3 kDa protein in frxC 3'region 6.77e-02 2.84e-02 NA
2. P P16486 Coat protein NA 4.04e-03 NA
2. P P12452 Virion infectivity factor NA 3.25e-02 NA
2. P P89905 Virion infectivity factor NA 9.82e-04 NA
2. P Q02841 Virion infectivity factor NA 9.06e-04 NA
2. P Q91BI6 Late expression factor 11 NA 9.56e-03 NA
2. P P05903 Virion infectivity factor NA 3.76e-02 NA
2. P Q8CC14 Protein FAM216B 3.80e-02 7.70e-04 NA
2. P P19506 Virion infectivity factor NA 1.24e-02 NA
2. P Q2J4G6 Nitrogenase-stabilizing/protective protein NifW 4.94e-02 1.60e-02 NA