Summary

Q0VAA2

Homolog: Q14BP6.
Function: Leucine-rich repeat-containing protein 74B.

Statistics

Total GO Annotation: 387
Unique PROST Go: 133
Unique BLAST Go: 238

Total Homologs: 234
Unique PROST Homologs: 124
Unique BLAST Homologs: 97

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q14BP6 (Leucine-rich repeat-containing protein 74B) with a FATCAT P-Value: 0.0 and RMSD of 1.68 angstrom. The sequence alignment identity is 27.6%.
Structural alignment shown in left. Query protein Q0VAA2 colored as red in alignment, homolog Q14BP6 colored as blue. Query protein Q0VAA2 is also shown in right top, homolog Q14BP6 showed in right bottom. They are colored based on secondary structures. 

  Q0VAA2 MHIQFPSKPTLPRACWEGRITAGSPGMP-PDEIEIEPVRQSSDKMLYCE---AESPPTVEKVKPAR---ENSETDLEIED----DEKFFTTGQKELYLEA 89
  Q14BP6 --------------------------MKGPCE-----VQKNEDQ----EGEAAATGPQAETLEAERSWTADSHSALEAEGTHGLGERVMAT----LYLKS 61

  Q0VAA2 CKLMGVVPVSYFIRNMEESYVNLNHHGLGPRGTKAIAIALVSNMAVTKLELEDN--CIMEEGVLSLVEMLQENYYLQEMNISNNHLGLEGARIISDFFER 187
  Q14BP6 CRANSVVPVSCLLRQEGASELNLRHRGLGPQGVRALASVLTSNPYIKRLDLRDNGLC--GAGAEALADVLRKNSIISDVDLSENQIGAAGLQAICTALAL 159

  Q0VAA2 NSSSIWSLELSGNDFKEDSAALLCQALSTNYQ-IKKLDLSHNQFSDVGGEHLGQMLAINVGLTSLDLSWNNFHTR--GAVALCNGLRGNVTLTKLDLSMN 284
  Q14BP6 N-PTVEKMQLQGNRLEEQAAQHLA-ALLLHHRGLKSLDLSYNQLNDLAGEILGPAVAENTGLTELNLSWN--HLRGLGATAFARGLEANIFLKVLDISHN 255

  Q0VAA2 GFGNEVALALGEVLRLNRCLVYLDIGGNDIGNEGASKISKGLESNESLRVLKLFLNPINMDGAILLILAIKRNPKSR-MEELDISNVLVS---EQF---M 377
  Q14BP6 GFGDSGASAIGDALRVNNVLEELNMRNNRISVSGALKLGLGLQVNQTLRILIISKNPIRSDGCVGLLKSV-RNNKSSALELLDVSDIQVSRECEDLASSM 354

  Q0VAA2 -KTLDGV----YAVH----PQLDVVFKAV-----QGLSPKKTIFLLTNPMKLIQSYADQHKITIVDFFKSLNPTGTMKMSVDEFQKVMIEQNKVPLNQYQ 463
  Q14BP6 SEILPGLCIKRYTSRRKDWPQASTPSQPASAPSDSGL--------------------------------------------------------------- 391

  Q0VAA2 VREVIKKLDEKTGMVNFSFLNTMKP 488
  Q14BP6 ------------------------- 391

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0006954 inflammatory response
1. PB GO:0036126 sperm flagellum
1. PB GO:0032757 positive regulation of interleukin-8 production
1. PB GO:0009524 phragmoplast
1. PB GO:0045471 response to ethanol
1. PB GO:0005096 GTPase activator activity
1. PB GO:0071222 cellular response to lipopolysaccharide
1. PB GO:0045944 positive regulation of transcription by RNA polymerase II
1. PB GO:0032760 positive regulation of tumor necrosis factor production
1. PB GO:0032495 response to muramyl dipeptide
1. PB GO:1901224 positive regulation of NIK/NF-kappaB signaling
1. PB GO:0014070 response to organic cyclic compound
1. PB GO:0045087 innate immune response
1. PB GO:0007165 signal transduction
1. PB GO:0070431 nucleotide-binding oligomerization domain containing 2 signaling pathway
1. PB GO:0030317 flagellated sperm motility
2. P GO:0010508 positive regulation of autophagy
2. P GO:0014889 muscle atrophy
2. P GO:0090141 positive regulation of mitochondrial fission
2. P GO:0070848 response to growth factor
2. P GO:0042994 cytoplasmic sequestering of transcription factor
2. P GO:0005589 collagen type VI trimer
2. P GO:0055046 microgametogenesis
2. P GO:0032496 response to lipopolysaccharide
2. P GO:0043202 lysosomal lumen
2. P GO:0051216 cartilage development
2. P GO:0006404 RNA import into nucleus
2. P GO:0034612 response to tumor necrosis factor
2. P GO:0010375 stomatal complex patterning
2. P GO:0005201 extracellular matrix structural constituent
2. P GO:0032914 positive regulation of transforming growth factor beta1 production
2. P GO:0005796 Golgi lumen
2. P GO:0001847 opsonin receptor activity
2. P GO:0002237 response to molecule of bacterial origin
2. P GO:0002718 regulation of cytokine production involved in immune response
2. P GO:0070171 negative regulation of tooth mineralization
2. P GO:0045121 membrane raft
2. P GO:0001819 positive regulation of cytokine production
2. P GO:0035307 positive regulation of protein dephosphorylation
2. P GO:0010888 negative regulation of lipid storage
2. P GO:0030021 extracellular matrix structural constituent conferring compression resistance
2. P GO:0042567 insulin-like growth factor ternary complex
2. P GO:0031430 M band
2. P GO:0005576 extracellular region
2. P GO:0032026 response to magnesium ion
2. P GO:0007021 tubulin complex assembly
2. P GO:0032729 positive regulation of interferon-gamma production
2. P GO:0019903 protein phosphatase binding
2. P GO:0010376 stomatal complex formation
2. P GO:0072542 protein phosphatase activator activity
2. P GO:0048495 Roundabout binding
2. P GO:0070891 lipoteichoic acid binding
2. P GO:0008330 protein tyrosine/threonine phosphatase activity
2. P GO:0005615 extracellular space
2. P GO:0009986 cell surface
2. P GO:0050840 extracellular matrix binding
2. P GO:0009897 external side of plasma membrane
2. P GO:0009612 response to mechanical stimulus
2. P GO:0014005 microglia development
2. P GO:0004722 protein serine/threonine phosphatase activity
2. P GO:0010745 negative regulation of macrophage derived foam cell differentiation
2. P GO:0007059 chromosome segregation
2. P GO:0071378 cellular response to growth hormone stimulus
2. P GO:0016239 positive regulation of macroautophagy
2. P GO:0035583 sequestering of TGFbeta in extracellular matrix
2. P GO:0048936 peripheral nervous system neuron axonogenesis
2. P GO:0030336 negative regulation of cell migration
2. P GO:1904027 negative regulation of collagen fibril organization
2. P GO:0009504 cell plate
2. P GO:0070062 extracellular exosome
2. P GO:0003341 cilium movement
2. P GO:0001822 kidney development
2. P GO:0017151 DEAD/H-box RNA helicase binding
2. P GO:0010090 trichome morphogenesis
2. P GO:0005520 insulin-like growth factor binding
2. P GO:0010073 meristem maintenance
2. P GO:0043231 intracellular membrane-bounded organelle
2. P GO:0061975 articular cartilage development
2. P GO:0071727 cellular response to triacyl bacterial lipopeptide
2. P GO:0042383 sarcolemma
2. P GO:0061303 cornea development in camera-type eye
2. P GO:0071219 cellular response to molecule of bacterial origin
2. P GO:0060348 bone development
2. P GO:1905034 regulation of antifungal innate immune response
2. P GO:0070427 nucleotide-binding oligomerization domain containing 1 signaling pathway
2. P GO:0014068 positive regulation of phosphatidylinositol 3-kinase signaling
2. P GO:1990727 tubulin folding cofactor complex
2. P GO:0010596 negative regulation of endothelial cell migration
2. P GO:0071726 cellular response to diacyl bacterial lipopeptide
2. P GO:0007568 aging
2. P GO:0030282 bone mineralization
2. P GO:0000911 cytokinesis by cell plate formation
2. P GO:0005614 interstitial matrix
2. P GO:0034142 toll-like receptor 4 signaling pathway
2. P GO:0098633 collagen fibril binding
2. P GO:0030500 regulation of bone mineralization
2. P GO:0036364 transforming growth factor beta1 activation
2. P GO:0007601 visual perception
2. P GO:1901222 regulation of NIK/NF-kappaB signaling
2. P GO:0051901 positive regulation of mitochondrial depolarization
2. P GO:0007023 post-chaperonin tubulin folding pathway
2. P GO:0019834 phospholipase A2 inhibitor activity
2. P GO:0071215 cellular response to abscisic acid stimulus
2. P GO:0006898 receptor-mediated endocytosis
2. P GO:0017017 MAP kinase tyrosine/serine/threonine phosphatase activity
2. P GO:0018996 molting cycle, collagen and cuticulin-based cuticle
2. P GO:0005518 collagen binding
2. P GO:0031012 extracellular matrix
2. P GO:0032481 positive regulation of type I interferon production
2. P GO:0055008 cardiac muscle tissue morphogenesis
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0071723 lipopeptide binding
2. P GO:0019888 protein phosphatase regulator activity
2. P GO:0005930 axoneme
2. P GO:0005539 glycosaminoglycan binding
2. P GO:0001530 lipopolysaccharide binding
2. P GO:0001890 placenta development
2. P GO:0008157 protein phosphatase 1 binding
2. P GO:0007155 cell adhesion
2. P GO:0007253 cytoplasmic sequestering of NF-kappaB
2. P GO:0071223 cellular response to lipoteichoic acid
2. P GO:0001974 blood vessel remodeling
2. P GO:0031362 anchored component of external side of plasma membrane
2. P GO:0043014 alpha-tubulin binding
2. P GO:0016019 peptidoglycan immune receptor activity
2. P GO:0009617 response to bacterium
2. P GO:0006407 rRNA export from nucleus
2. P GO:0019800 peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan
2. P GO:0046696 lipopolysaccharide receptor complex
2. P GO:0051602 response to electrical stimulus
2. P GO:0031663 lipopolysaccharide-mediated signaling pathway
2. P GO:0005583 fibrillar collagen trimer
2. P GO:0046579 positive regulation of Ras protein signal transduction
2. P GO:0031514 motile cilium
2. P GO:0098868 bone growth
2. P GO:0030199 collagen fibril organization
2. P GO:0033256 I-kappaB/NF-kappaB complex
2. P GO:0016525 negative regulation of angiogenesis
2. P GO:0047485 protein N-terminus binding
2. P GO:0006409 tRNA export from nucleus
2. P GO:0006606 protein import into nucleus
2. P GO:0007519 skeletal muscle tissue development
2. P GO:0030133 transport vesicle
2. P GO:0062023 collagen-containing extracellular matrix
2. P GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
2. P GO:0042060 wound healing
2. P GO:0000164 protein phosphatase type 1 complex
2. P GO:0045807 positive regulation of endocytosis
2. P GO:1900747 negative regulation of vascular endothelial growth factor signaling pathway
3. B GO:0036336 dendritic cell migration
3. B GO:0009729 detection of brassinosteroid stimulus
3. B GO:0050680 negative regulation of epithelial cell proliferation
3. B GO:0051656 establishment of organelle localization
3. B GO:0002526 acute inflammatory response
3. B GO:0045630 positive regulation of T-helper 2 cell differentiation
3. B GO:0044319 wound healing, spreading of cells
3. B GO:0036312 phosphatidylinositol 3-kinase regulatory subunit binding
3. B GO:0045111 intermediate filament cytoskeleton
3. B GO:0032701 negative regulation of interleukin-18 production
3. B GO:0072559 NLRP3 inflammasome complex
3. B GO:0009595 detection of biotic stimulus
3. B GO:0032720 negative regulation of tumor necrosis factor production
3. B GO:0044351 macropinocytosis
3. B GO:1900140 regulation of seedling development
3. B GO:0032755 positive regulation of interleukin-6 production
3. B GO:0051639 actin filament network formation
3. B GO:0002925 positive regulation of humoral immune response mediated by circulating immunoglobulin
3. B GO:0010942 positive regulation of cell death
3. B GO:0031953 negative regulation of protein autophosphorylation
3. B GO:0072558 NLRP1 inflammasome complex
3. B GO:0043549 regulation of kinase activity
3. B GO:0030016 myofibril
3. B GO:2000553 positive regulation of T-helper 2 cell cytokine production
3. B GO:0043280 positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B GO:0071345 cellular response to cytokine stimulus
3. B GO:0048147 negative regulation of fibroblast proliferation
3. B GO:0031297 replication fork processing
3. B GO:0031965 nuclear membrane
3. B GO:0060471 cortical granule exocytosis
3. B GO:0032733 positive regulation of interleukin-10 production
3. B GO:0060340 positive regulation of type I interferon-mediated signaling pathway
3. B GO:0032879 regulation of localization
3. B GO:0030032 lamellipodium assembly
3. B GO:0002710 negative regulation of T cell mediated immunity
3. B GO:0032498 detection of muramyl dipeptide
3. B GO:0071224 cellular response to peptidoglycan
3. B GO:0007270 neuron-neuron synaptic transmission
3. B GO:0044877 protein-containing complex binding
3. B GO:1904417 positive regulation of xenophagy
3. B GO:0043552 positive regulation of phosphatidylinositol 3-kinase activity
3. B GO:0030426 growth cone
3. B GO:0042834 peptidoglycan binding
3. B GO:0045751 negative regulation of Toll signaling pathway
3. B GO:0032754 positive regulation of interleukin-5 production
3. B GO:0035101 FACT complex
3. B GO:0002732 positive regulation of dendritic cell cytokine production
3. B GO:1900016 negative regulation of cytokine production involved in inflammatory response
3. B GO:0004864 protein phosphatase inhibitor activity
3. B GO:0016500 protein-hormone receptor activity
3. B GO:0030838 positive regulation of actin filament polymerization
3. B GO:0002830 positive regulation of type 2 immune response
3. B GO:0140297 DNA-binding transcription factor binding
3. B GO:0061851 leading edge of lamellipodium
3. B GO:0140608 cysteine-type endopeptidase activator activity
3. B GO:1900029 positive regulation of ruffle assembly
3. B GO:0010592 positive regulation of lamellipodium assembly
3. B GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation
3. B GO:0090091 positive regulation of extracellular matrix disassembly
3. B GO:0042110 T cell activation
3. B GO:0007163 establishment or maintenance of cell polarity
3. B GO:0050871 positive regulation of B cell activation
3. B GO:2000363 positive regulation of prostaglandin-E synthase activity
3. B GO:0046645 positive regulation of gamma-delta T cell activation
3. B GO:0051293 establishment of spindle localization
3. B GO:0032494 response to peptidoglycan
3. B GO:0002227 innate immune response in mucosa
3. B GO:0050766 positive regulation of phagocytosis
3. B GO:0051496 positive regulation of stress fiber assembly
3. B GO:0070269 pyroptosis
3. B GO:1901223 negative regulation of NIK/NF-kappaB signaling
3. B GO:0030011 maintenance of cell polarity
3. B GO:0016323 basolateral plasma membrane
3. B GO:0032753 positive regulation of interleukin-4 production
3. B GO:1990723 cytoplasmic periphery of the nuclear pore complex
3. B GO:0030277 maintenance of gastrointestinal epithelium
3. B GO:0046415 urate metabolic process
3. B GO:2000321 positive regulation of T-helper 17 cell differentiation
3. B GO:0030544 Hsp70 protein binding
3. B GO:0002862 negative regulation of inflammatory response to antigenic stimulus
3. B GO:0048657 anther wall tapetum cell differentiation
3. B GO:0050700 CARD domain binding
3. B GO:0060339 negative regulation of type I interferon-mediated signaling pathway
3. B GO:0016235 aggresome
3. B GO:0051770 positive regulation of nitric-oxide synthase biosynthetic process
3. B GO:0045765 regulation of angiogenesis
3. B GO:0045345 positive regulation of MHC class I biosynthetic process
3. B GO:0031252 cell leading edge
3. B GO:0045089 positive regulation of innate immune response
3. B GO:0005865 striated muscle thin filament
3. B GO:0051694 pointed-end actin filament capping
3. B GO:0006936 muscle contraction
3. B GO:0051092 positive regulation of NF-kappaB transcription factor activity
3. B GO:0009755 hormone-mediated signaling pathway
3. B GO:0006913 nucleocytoplasmic transport
3. B GO:0019966 interleukin-1 binding
3. B GO:0051353 positive regulation of oxidoreductase activity
3. B GO:0089720 caspase binding
3. B GO:0005856 cytoskeleton
3. B GO:0045824 negative regulation of innate immune response
3. B GO:0061339 establishment or maintenance of monopolar cell polarity
3. B GO:0034315 regulation of Arp2/3 complex-mediated actin nucleation
3. B GO:0009934 regulation of meristem structural organization
3. B GO:0043124 negative regulation of I-kappaB kinase/NF-kappaB signaling
3. B GO:0005635 nuclear envelope
3. B GO:0008656 cysteine-type endopeptidase activator activity involved in apoptotic process
3. B GO:0039536 negative regulation of RIG-I signaling pathway
3. B GO:0061702 inflammasome complex
3. B GO:0071225 cellular response to muramyl dipeptide
3. B GO:0007015 actin filament organization
3. B GO:0060473 cortical granule
3. B GO:0032661 regulation of interleukin-18 production
3. B GO:0002606 positive regulation of dendritic cell antigen processing and presentation
3. B GO:0045745 positive regulation of G protein-coupled receptor signaling pathway
3. B GO:0048678 response to axon injury
3. B GO:0030239 myofibril assembly
3. B GO:0002674 negative regulation of acute inflammatory response
3. B GO:0044546 NLRP3 inflammasome complex assembly
3. B GO:0038187 pattern recognition receptor activity
3. B GO:0031529 ruffle organization
3. B GO:0098641 cadherin binding involved in cell-cell adhesion
3. B GO:0016715 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced ascorbate as one donor, and incorporation of one atom of oxygen
3. B GO:0007249 I-kappaB kinase/NF-kappaB signaling
3. B GO:0002720 positive regulation of cytokine production involved in immune response
3. B GO:0046330 positive regulation of JNK cascade
3. B GO:0050728 negative regulation of inflammatory response
3. B GO:0043281 regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B GO:1904784 NLRP1 inflammasome complex assembly
3. B GO:0014067 negative regulation of phosphatidylinositol 3-kinase signaling
3. B GO:1905246 negative regulation of aspartic-type peptidase activity
3. B GO:0005523 tropomyosin binding
3. B GO:0030027 lamellipodium
3. B GO:0010305 leaf vascular tissue pattern formation
3. B GO:0044614 nuclear pore cytoplasmic filaments
3. B GO:0032735 positive regulation of interleukin-12 production
3. B GO:0046597 negative regulation of viral entry into host cell
3. B GO:0070374 positive regulation of ERK1 and ERK2 cascade
3. B GO:0034136 negative regulation of toll-like receptor 2 signaling pathway
3. B GO:0032715 negative regulation of interleukin-6 production
3. B GO:0007611 learning or memory
3. B GO:0050679 positive regulation of epithelial cell proliferation
3. B GO:0008428 ribonuclease inhibitor activity
3. B GO:0032692 negative regulation of interleukin-1 production
3. B GO:0009968 negative regulation of signal transduction
3. B GO:0043596 nuclear replication fork
3. B GO:0006887 exocytosis
3. B GO:0071639 positive regulation of monocyte chemotactic protein-1 production
3. B GO:1901992 positive regulation of mitotic cell cycle phase transition
3. B GO:0036064 ciliary basal body
3. B GO:0043122 regulation of I-kappaB kinase/NF-kappaB signaling
3. B GO:0032687 negative regulation of interferon-alpha production
3. B GO:0009956 radial pattern formation
3. B GO:0046826 negative regulation of protein export from nucleus
3. B GO:0009825 multidimensional cell growth
3. B GO:0030335 positive regulation of cell migration
3. B GO:0032088 negative regulation of NF-kappaB transcription factor activity
3. B GO:0009933 meristem structural organization
3. B GO:0045348 positive regulation of MHC class II biosynthetic process
3. B GO:0060335 positive regulation of interferon-gamma-mediated signaling pathway
3. B GO:0051879 Hsp90 protein binding
3. B GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB signaling
3. B GO:0051000 positive regulation of nitric-oxide synthase activity
3. B GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
3. B GO:0051607 defense response to virus
3. B GO:0002523 leukocyte migration involved in inflammatory response
3. B GO:0072423 response to DNA damage checkpoint signaling
3. B GO:0042393 histone binding
3. B GO:0002253 activation of immune response
3. B GO:0032731 positive regulation of interleukin-1 beta production
3. B GO:1902523 positive regulation of protein K63-linked ubiquitination
3. B GO:0032741 positive regulation of interleukin-18 production
3. B GO:0070373 negative regulation of ERK1 and ERK2 cascade
3. B GO:0032689 negative regulation of interferon-gamma production
3. B GO:0002221 pattern recognition receptor signaling pathway
3. B GO:0032703 negative regulation of interleukin-2 production
3. B GO:0032695 negative regulation of interleukin-12 production
3. B GO:2000813 negative regulation of barbed-end actin filament capping
3. B GO:0007584 response to nutrient
3. B GO:0032311 angiogenin-PRI complex
3. B GO:2000110 negative regulation of macrophage apoptotic process
3. B GO:1900017 positive regulation of cytokine production involved in inflammatory response
3. B GO:0017024 myosin I binding
3. B GO:0043330 response to exogenous dsRNA
3. B GO:0005814 centriole
3. B GO:0010584 pollen exine formation
3. B GO:0000724 double-strand break repair via homologous recombination
3. B GO:0090022 regulation of neutrophil chemotaxis
3. B GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
3. B GO:0032736 positive regulation of interleukin-13 production
3. B GO:0034341 response to interferon-gamma
3. B GO:0042585 germinal vesicle
3. B GO:0043487 regulation of RNA stability
3. B GO:0051638 barbed-end actin filament uncapping
3. B GO:0106333 subcortical maternal complex
3. B GO:1902745 positive regulation of lamellipodium organization
3. B GO:0042981 regulation of apoptotic process
3. B GO:0016021 integral component of membrane
3. B GO:1904115 axon cytoplasm
3. B GO:0051302 regulation of cell division
3. B GO:0010268 brassinosteroid homeostasis
3. B GO:0045747 positive regulation of Notch signaling pathway
3. B GO:0006915 apoptotic process
3. B GO:0005813 centrosome
3. B GO:0070685 macropinocytic cup
3. B GO:0006963 positive regulation of antibacterial peptide biosynthetic process
3. B GO:0005829 cytosol
3. B GO:0032740 positive regulation of interleukin-17 production
3. B GO:0032691 negative regulation of interleukin-1 beta production
3. B GO:0003779 actin binding
3. B GO:0043406 positive regulation of MAP kinase activity
3. B GO:0040019 positive regulation of embryonic development
3. B GO:0032090 Pyrin domain binding
3. B GO:0042555 MCM complex
3. B GO:0001818 negative regulation of cytokine production
3. B GO:0032688 negative regulation of interferon-beta production
3. B GO:0031982 vesicle
3. B GO:0010540 basipetal auxin transport
3. B GO:0060585 positive regulation of prostaglandin-endoperoxide synthase activity
3. B GO:0035556 intracellular signal transduction
3. B GO:0015631 tubulin binding
3. B GO:0050727 regulation of inflammatory response
3. B GO:0046658 anchored component of plasma membrane
3. B GO:0032874 positive regulation of stress-activated MAPK cascade
3. B GO:0072557 IPAF inflammasome complex
3. B GO:0016045 detection of bacterium
3. B GO:0044782 cilium organization
3. B GO:0042742 defense response to bacterium
3. B GO:0071407 cellular response to organic cyclic compound
3. B GO:0045335 phagocytic vesicle
3. B GO:0006965 positive regulation of biosynthetic process of antibacterial peptides active against Gram-positive bacteria
3. B GO:1904117 cellular response to vasopressin
3. B GO:0044354 macropinosome
3. B GO:0005662 DNA replication factor A complex
3. B GO:0050830 defense response to Gram-positive bacterium
3. B GO:0032500 muramyl dipeptide binding
3. B GO:0031941 filamentous actin
3. B GO:1900226 negative regulation of NLRP3 inflammasome complex assembly
3. B GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9LE82 RAN GTPase-activating protein 1 2.62e-08 2.37e-12 2.04e-09
1. PB A8HMZ4 Dynein regulatory complex subunit 5 1.35e-10 3.53e-04 1.73e-19
1. PB Q9DAM1 Leucine-rich repeat-containing protein 34 1.67e-15 3.79e-08 3.98e-13
1. PB Q0VAA2 Leucine-rich repeat-containing protein 74A 0 2.67e-140 0.0
1. PB Q9M651 RAN GTPase-activating protein 2 1.90e-07 3.99e-08 1.08e-14
1. PB A0JPI9 Leucine-rich repeat-containing protein 74A 0.00e+00 2.64e-43 0.0
1. PB Q9D3W5 Leucine-rich repeat-containing protein 71 2.06e-03 9.53e-05 6.73e-05
1. PB Q14BP6 Leucine-rich repeat-containing protein 74B 0.00e+00 1.87e-14 6.77e-61
1. PB Q8IZ02 Leucine-rich repeat-containing protein 34 3.40e-11 5.66e-16 1.04e-13
1. PB Q6ZQY2 Leucine-rich repeat-containing protein 74B 3.33e-16 1.78e-17 1.58e-62
1. PB Q1L994 Protein phosphatase 1 regulatory subunit 37 8.18e-08 4.08e-06 5.70e-08
1. PB Q8N4P6 Leucine-rich repeat-containing protein 71 6.62e-04 2.73e-05 7.81e-06
1. PB Q4V8D9 Leucine-rich repeat-containing protein 34 1.11e-15 8.28e-07 6.83e-14
2. P Q6PEZ8 Podocan-like protein 1 2.24e-04 3.61e-03 NA
2. P Q3ZBN5 Asporin 3.79e-05 5.24e-03 NA
2. P Q9Y546 Leucine-rich repeat-containing protein 42 1.60e-02 1.06e-09 NA
2. P Q65YW8 Tsukushi-A 2.80e-03 9.87e-03 NA
2. P P28653 Biglycan 7.62e-05 1.01e-04 NA
2. P O46542 Decorin 7.60e-04 2.06e-04 NA
2. P Q9BYS8 Leucine-rich repeat-containing protein 2 1.81e-03 3.92e-03 NA
2. P P58823 Polygalacturonase inhibitor 3 1.78e-03 3.65e-02 NA
2. P Q9SJH6 Receptor like protein 29 1.31e-03 4.36e-02 NA
2. P Q8AVI4 Leucine-rich repeat protein SHOC-2 1.25e-03 2.75e-02 NA
2. P Q6P5J6 Leucine-rich repeat-containing protein 42 6.06e-03 2.19e-07 NA
2. P B4IBI9 Leucine-rich repeat protein soc-2 homolog 1.34e-03 3.97e-02 NA
2. P A2RTY3 Protein HEATR9 8.79e-02 1.30e-02 NA
2. P Q5RAV5 Leucine-rich repeat protein SHOC-2 3.58e-03 2.04e-02 NA
2. P Q7XK44 Plant intracellular Ras-group-related LRR protein 3 9.30e-04 2.21e-02 NA
2. P A6NHZ5 Leucine-rich repeat-containing protein 14B 3.71e-05 5.65e-04 NA
2. P Q5HZV9 Protein phosphatase 1 regulatory subunit 7 2.14e-04 3.76e-03 NA
2. P Q5FVQ9 Tubulin-specific chaperone E 3.18e-04 3.32e-02 NA
2. P P02750 Leucine-rich alpha-2-glycoprotein 7.97e-04 1.18e-07 NA
2. P Q9DE68 Decorin 1.04e-04 7.55e-06 NA
2. P Q9CQ76 Nephrocan 3.77e-04 1.88e-04 NA
2. P Q9LRV8 Plant intracellular Ras-group-related LRR protein 2 8.71e-04 1.62e-04 NA
2. P P51885 Lumican 3.74e-05 3.45e-02 NA
2. P Q9UQ13 Leucine-rich repeat protein SHOC-2 7.09e-03 2.04e-02 NA
2. P O93233 Phospholipase A2 inhibitor 7.40e-05 3.54e-03 NA
2. P P51884 Lumican 2.18e-04 5.34e-03 NA
2. P O88520 Leucine-rich repeat protein SHOC-2 7.00e-04 1.20e-02 NA
2. P A6NM36 Leucine-rich repeat-containing protein 30 6.70e-05 1.07e-05 NA
2. P Q9XSD9 Decorin 8.50e-05 8.59e-06 NA
2. P Q6AYI5 Leucine-rich repeat protein SHOC-2 1.05e-03 1.07e-02 NA
2. P Q587K4 Leucine-rich repeat-containing protein 73 1.16e-10 2.58e-03 NA
2. P Q5RFS7 Protein phosphatase 1 regulatory subunit 7 3.28e-05 2.86e-03 NA
2. P P07585 Decorin 1.28e-04 1.36e-04 NA
2. P Q3UM45 Protein phosphatase 1 regulatory subunit 7 1.32e-04 6.21e-03 NA
2. P Q28680 Monocyte differentiation antigen CD14 6.06e-05 2.11e-03 NA
2. P F1R6I3 Leucine-rich repeat-containing protein 39 5.03e-04 6.03e-05 NA
2. P P70389 Insulin-like growth factor-binding protein complex acid labile subunit 3.92e-03 4.30e-05 NA
2. P Q8W4Q3 Plant intracellular Ras-group-related LRR protein 3 8.38e-04 6.29e-04 NA
2. P Q9SHI4 Receptor-like protein 3 6.29e-03 3.38e-02 NA
2. P Q6C417 U2 small nuclear ribonucleoprotein A' 1.36e-02 3.01e-04 NA
2. P Q8TBY9 Cilia- and flagella-associated protein 251 9.13e-01 2.24e-03 NA
2. P Q3UV48 Leucine-rich repeat-containing protein 30 3.28e-04 1.86e-02 NA
2. P Q7Z5L7 Podocan 1.46e-03 7.63e-05 NA
2. P Q95122 Monocyte differentiation antigen CD14 7.61e-04 1.70e-03 NA
2. P B3P3E8 Leucine-rich repeat protein soc-2 homolog 5.26e-04 8.11e-03 NA
2. P O42235 Keratocan 1.27e-05 2.55e-02 NA
2. P Q9IB75 Biglycan 2.47e-04 4.47e-04 NA
2. P P36047 Protein phosphatase 1 regulatory subunit SDS22 6.89e-05 1.55e-02 NA
2. P Q7TQ62 Podocan 1.45e-03 1.90e-03 NA
2. P Q9LUI1 Leucine-rich repeat extensin-like protein 6 2.05e-03 4.44e-02 NA
2. P P21810 Biglycan 4.02e-05 8.15e-05 NA
2. P Q4R6F0 Leucine-rich repeat and death domain-containing protein 1 5.55e-03 4.35e-05 NA
2. P P08571 Monocyte differentiation antigen CD14 5.00e-04 3.18e-06 NA
2. P O46403 Biglycan 2.62e-04 2.73e-04 NA
2. P O02833 Insulin-like growth factor-binding protein complex acid labile subunit 1.10e-03 4.98e-03 NA
2. P O62702 Keratocan 3.15e-06 2.77e-02 NA
2. P Q9Z1S7 Osteomodulin 2.43e-05 2.79e-06 NA
2. P D3ZXS4 Leucine-rich repeat-containing protein 39 6.04e-04 7.89e-05 NA
2. P Q53EV4 Leucine-rich repeat-containing protein 23 2.33e-04 4.32e-02 NA
2. P O02678 Biglycan 2.09e-04 2.39e-04 NA
2. P Q9TTE2 Decorin 8.75e-05 5.51e-05 NA
2. P P11745 Ran GTPase-activating protein 1 3.82e-12 7.89e-05 NA
2. P P47853 Biglycan 1.33e-04 7.80e-05 NA
2. P Q1L8H0 Leucine-rich repeat-containing protein 14B 7.28e-05 7.93e-04 NA
2. P Q3UJB3 Leucine-rich repeat-containing protein 14B 1.54e-05 3.75e-05 NA
2. P Q54Y32 MAP kinase phosphatase with leucine-rich repeats protein 3 8.94e-02 2.13e-03 NA
2. P Q5R1V9 Decorin 2.26e-04 1.36e-04 NA
2. P P28654 Decorin 9.79e-05 3.84e-05 NA
2. P Q28CU0 Leucine-rich repeat-containing protein 23 2.38e-04 3.02e-02 NA
2. P B3LWU3 Leucine-rich repeat protein soc-2 homolog 1.37e-03 2.88e-02 NA
2. P Q4KLV2 Leucine-rich repeat-containing protein 42 7.80e-02 7.41e-07 NA
2. P Q9U3A0 P-granule-associated novel protein 1 2.95e-03 3.97e-02 NA
2. P B4QVR7 Leucine-rich repeat protein soc-2 homolog 1.28e-03 1.43e-02 NA
2. P P10810 Monocyte differentiation antigen CD14 5.36e-05 1.56e-02 NA
2. P Q99983 Osteomodulin 2.48e-05 3.03e-05 NA
2. P Q15435 Protein phosphatase 1 regulatory subunit 7 5.30e-05 9.28e-04 NA
2. P Q2HJ90 Leucine-rich repeat-containing protein 42 4.92e-02 1.97e-11 NA
2. P Q96DD0 Leucine-rich repeat-containing protein 39 6.70e-04 5.73e-03 NA
2. P O64566 Plant intracellular Ras-group-related LRR protein 6 3.07e-04 2.36e-03 NA
2. P O60938 Keratocan 2.67e-05 2.61e-03 NA
2. P P35859 Insulin-like growth factor-binding protein complex acid labile subunit 5.60e-04 1.60e-03 NA
2. P Q29393 Decorin 2.89e-05 5.62e-06 NA
2. P Q8LB33 F-box protein At3g58530 3.95e-05 1.08e-02 NA
2. P Q8C0R9 Leucine-rich repeat and death domain-containing protein 1 8.05e-03 1.08e-04 NA
2. P O77742 Osteomodulin 7.98e-04 5.77e-04 NA
2. P Q4KM95 Leucine-rich repeat-containing protein 42 6.67e-03 1.65e-09 NA
2. P O35367 Keratocan 2.19e-05 3.65e-02 NA
2. P Q8BGI7 Leucine-rich repeat-containing protein 39 3.20e-04 1.26e-03 NA
2. P P51886 Lumican 5.96e-05 2.52e-02 NA
2. P Q54Q39 Protein phosphatase 1 regulatory subunit pprA 3.36e-05 2.33e-03 NA
2. P C0STK7 Phospholipase A2 inhibitor beta NA 4.16e-03 NA
2. P Q55CN0 Tubulin-specific chaperone E 1.06e-03 1.21e-03 NA
2. P Q5JTD7 Leucine-rich repeat-containing protein 73 1.23e-14 2.69e-03 NA
2. P P25963 NF-kappa-B inhibitor alpha 4.05e-01 3.38e-02 NA
2. P Q9SSD1 Protein TOO MANY MOUTHS 2.03e-03 3.30e-03 NA
2. P A6QLV3 Leucine-rich repeat protein SHOC-2 1.27e-03 3.17e-02 NA
2. P Q8R2U7 Leucine-rich repeat-containing protein 42 6.35e-02 1.78e-10 NA
2. P P21809 Biglycan 1.91e-04 2.22e-04 NA
2. P O35103 Osteomodulin 1.62e-03 6.45e-05 NA
2. P Q99MQ4 Asporin 2.47e-05 3.79e-02 NA
2. P Q01129 Decorin 1.58e-04 2.61e-04 NA
2. P P41391 Ran GTPase-activating protein 1 1.23e-09 1.28e-04 NA
2. P P28675 Decorin 2.32e-04 1.55e-04 NA
2. P Q9FFJ3 Plant intracellular Ras-group-related LRR protein 1 8.37e-03 1.99e-02 NA
2. P B4LXW1 Leucine-rich repeat protein soc-2 homolog 5.38e-04 3.61e-03 NA
2. P Q3ZC49 Leucine-rich repeat-containing protein 39 3.75e-04 2.85e-04 NA
2. P Q10303 Cell polarity protein alp21 3.62e-04 2.15e-03 NA
2. P A4D1F6 Leucine-rich repeat and death domain-containing protein 1 7.57e-03 7.85e-04 NA
2. P O46390 Biglycan 2.94e-03 5.76e-05 NA
2. P Q6AXL3 Transforming growth factor beta activator LRRC33 8.13e-04 4.24e-03 NA
2. P Q3T0W4 Protein phosphatase 1 regulatory subunit 7 1.26e-04 3.17e-03 NA
2. P Q5RE88 Cilia- and flagella-associated protein 251 9.02e-01 4.51e-03 NA
2. P A7SFP1 Leucine-rich repeat protein soc-2 homolog 3.20e-03 1.91e-02 NA
2. P Q9DE66 Keratocan 4.76e-05 2.19e-02 NA
2. P Q0V9Y8 Leucine-rich repeat-containing protein 42 1.41e-02 2.96e-10 NA
2. P P35858 Insulin-like growth factor-binding protein complex acid labile subunit 1.09e-03 9.31e-03 NA
2. P Q6UY01 Leucine-rich repeat-containing protein 31 1.43e-06 3.55e-08 NA
2. P Q5F4C4 Leucine-rich repeat protein SHOC-2 4.68e-04 4.19e-04 NA
2. P Q05443 Lumican 2.51e-04 2.42e-04 NA
2. P Q63691 Monocyte differentiation antigen CD14 5.23e-04 7.49e-03 NA
2. P P21793 Decorin 5.86e-05 1.87e-05 NA
2. P Q6ZH85 Plant intracellular Ras-group-related LRR protein 2 1.28e-03 5.73e-03 NA
2. P Q8VDB8 Leucine-rich repeat-containing protein 2 1.03e-03 3.88e-05 NA
2. P Q28888 Decorin 6.44e-05 2.56e-04 NA
3. B Q6IRU7 Centrosomal protein of 78 kDa 1.91e-04 NA 3.29e-04
3. B C6FG12 Protein NLRC5 7.93e-03 NA 1.05e-08
3. B Q5VZK9 F-actin-uncapping protein LRRC16A 4.09e-04 NA 3.35e-07
3. B Q66X19 NACHT, LRR and PYD domains-containing protein 4E 2.12e-05 NA 3.13e-04
3. B P10775 Ribonuclease inhibitor 6.50e-10 NA 3.62e-09
3. B A6QLE5 NACHT, LRR and PYD domains-containing protein 3 3.73e-06 NA 1.85e-09
3. B A6H639 Dynein regulatory complex subunit 5 1.51e-05 NA 1.17e-13
3. B Q86WI3 Protein NLRC5 3.18e-03 NA 4.32e-14
3. B P0CD60 FERM domain-containing protein C 6.50e-05 NA 4.35e-12
3. B Q96P20 NACHT, LRR and PYD domains-containing protein 3 1.21e-07 NA 1.44e-07
3. B Q8WX94 NACHT, LRR and PYD domains-containing protein 7 2.96e-05 NA 9.08e-06
3. B Q3TL44 NLR family member X1 1.20e-03 NA 3.10e-04
3. B Q9Y239 Nucleotide-binding oligomerization domain-containing protein 1 2.18e-07 NA 3.99e-13
3. B A9JR78 Tonsoku-like protein 4.19e-05 NA 6.04e-05
3. B A8Y3R9 Protein phosphatase 1 regulatory subunit 37 homolog 2.19e-07 NA 1.99e-12
3. B Q96CN5 Leucine-rich repeat-containing protein 45 7.79e-05 NA 3.05e-16
3. B Q9C000 NACHT, LRR and PYD domains-containing protein 1 4.59e-03 NA 1.79e-05
3. B Q5DU56 Protein NLRC3 9.80e-07 NA 1.45e-28
3. B Q5JU00 Dynein regulatory complex subunit 5 6.63e-07 NA 2.78e-13
3. B A7Z026 Protein phosphatase 1 regulatory subunit 37 3.12e-09 NA 2.21e-11
3. B Q53B88 Nucleotide-binding oligomerization domain-containing protein 2 3.19e-07 NA 1.63e-13
3. B P33076 MHC class II transactivator 1.73e-03 NA 0.004
3. B C3VPR6 Protein NLRC5 1.36e-03 NA 7.73e-10
3. B Q3UFQ8 Capping protein, Arp2/3 and myosin-I linker protein 3 5.51e-04 NA 1.31e-05
3. B Q6B966 NACHT, LRR and PYD domains-containing protein 14 7.16e-07 NA 1.97e-04
3. B P59045 NACHT, LRR and PYD domains-containing protein 11 1.70e-07 NA 1.79e-06
3. B Q9R1M5 NACHT, LRR and PYD domains-containing protein 5 1.07e-05 NA 9.48e-09
3. B Q6EDY6 F-actin-uncapping protein LRRC16A 3.98e-04 NA 9.44e-07
3. B P13489 Ribonuclease inhibitor 1.31e-09 NA 3.84e-08
3. B Q0VC48 Tropomodulin-4 2.68e-04 NA 2.87e-04
3. B P14195 Leucine-rich repeat-containing protein AAC1 2.55e-06 NA 8.18e-09
3. B B2RYF1 Protein phosphatase 1 regulatory subunit 37 8.34e-08 NA 7.80e-11
3. B Q66X03 NACHT, LRR and PYD domains-containing protein 9A 2.02e-06 NA 4.76e-06
3. B Q8K3Z0 Nucleotide-binding oligomerization domain-containing protein 2 1.39e-07 NA 5.19e-13
3. B Q9NZR1 Tropomodulin-2 2.36e-04 NA 7.43e-05
3. B Q86W25 NACHT, LRR and PYD domains-containing protein 13 2.20e-07 NA 1.60e-09
3. B P59047 NACHT, LRR and PYD domains-containing protein 5 3.57e-05 NA 2.54e-13
3. B Q54G18 Rho GTPase-activating protein gacW 8.44e-05 NA 2.64e-10
3. B Q8CIM1 Leucine-rich repeat-containing protein 45 1.18e-04 NA 1.89e-16
3. B Q9JKK7 Tropomodulin-2 2.96e-04 NA 2.51e-04
3. B Q9HC29 Nucleotide-binding oligomerization domain-containing protein 2 8.62e-08 NA 1.52e-13
3. B P29315 Ribonuclease inhibitor 6.70e-10 NA 2.20e-13
3. B E1BTG2 Leiomodin-2 8.75e-03 NA 0.004
3. B P34342 Ran GTPase-activating protein 2 2.26e-04 NA 4.87e-04
3. B Q5XHY1 Capping protein, Arp2/3 and myosin-I linker protein 3 3.09e-04 NA 1.28e-05
3. B Q6F5E8 Capping protein, Arp2/3 and myosin-I linker protein 2 5.76e-04 NA 8.90e-06
3. B Q9FJ57 Protein TORNADO 1 2.86e-03 NA 0.002
3. B Q86W28 NACHT, LRR and PYD domains-containing protein 8 3.24e-05 NA 8.91e-06
3. B P46060 Ran GTPase-activating protein 1 2.80e-08 NA 5.37e-06
3. B Q91VI7 Ribonuclease inhibitor 6.45e-10 NA 4.19e-12
3. B Q7RTR2 NLR family CARD domain-containing protein 3 9.42e-07 NA 5.12e-26
3. B Q8C6J9 NACHT, LRR and PYD domains-containing protein 4B 1.79e-07 NA 3.10e-05
3. B F7D3V9 Leucine-rich repeat-containing G-protein coupled receptor 5 3.44e-02 NA 0.020
3. B Q6Q4D0 Protein TONSOKU 9.74e-04 NA 2.24e-04
3. B Q4R642 Dynein regulatory complex subunit 5 1.27e-06 NA 1.53e-13
3. B O13066 Ran GTPase-activating protein 1 1.53e-07 NA 2.30e-06
3. B Q8BKR5 Protein phosphatase 1 regulatory subunit 37 6.31e-08 NA 5.05e-11
3. B D4A615 Tonsoku-like protein 2.23e-04 NA 0.002
3. B Q3TKR3 NACHT, LRR and PYD domains-containing protein 4C 4.45e-09 NA 0.021
3. B P46061 Ran GTPase-activating protein 1 2.84e-07 NA 2.31e-05
3. B Q3V3V9 Capping protein, Arp2/3 and myosin-I linker protein 2 3.41e-04 NA 6.37e-06
3. B Q5JTW2 Centrosomal protein of 78 kDa 5.34e-05 NA 0.005
3. B Q288C4 NACHT, LRR and PYD domains-containing protein 9 1.55e-09 NA 2.92e-09
3. B Q66X01 NACHT, LRR and PYD domains-containing protein 9C 1.25e-07 NA 1.77e-05
3. B E9Q5R7 NACHT, LRR and PYD domains-containing protein 12 8.93e-07 NA 4.07e-16
3. B Q4UNE4 Putative ankyrin repeat protein RF_0063 1.27e-02 NA 0.029
3. B P59046 NACHT, LRR and PYD domains-containing protein 12 5.25e-06 NA 1.43e-11
3. B Q9NYL9 Tropomodulin-3 6.48e-04 NA 0.003
3. B Q9VIW3 Ran GTPase-activating protein 5.96e-08 NA 2.37e-10
3. B Q5ZI11 Leucine-rich repeat-containing protein 45 2.27e-05 NA 3.19e-14
3. B Q1ZXD6 Probable serine/threonine-protein kinase roco5 NA NA 3.58e-05
3. B Q647I9 NACHT, LRR and PYD domains-containing protein 5 3.65e-07 NA 1.87e-10
3. B Q8HZP9 Ribonuclease inhibitor 9.06e-10 NA 1.91e-07
3. B Q19857 Protein phosphatase 1 regulatory subunit 37 homolog 9.89e-08 NA 2.01e-11
3. B Q0P5G1 Tonsoku-like protein 1.83e-05 NA 4.37e-05
3. B Q86UT6 NLR family member X1 1.28e-03 NA 0.001
3. B B0FPE9 NACHT, LRR and PYD domains-containing protein 3 3.15e-07 NA 1.34e-07
3. B Q9JLH8 Tropomodulin-4 8.57e-04 NA 0.001
3. B Q95VZ3 Protein CARMIL 1.01e-05 NA 4.00e-10
3. B A2RRS8 Centrosomal protein of 78 kDa 1.45e-04 NA 0.001
3. B Q6E804 Nucleotide-binding oligomerization domain-containing protein 2 2.92e-07 NA 1.17e-10
3. B Q3UP24 NLR family CARD domain-containing protein 4 1.02e-03 NA 0.040
3. B Q8ND23 Capping protein, Arp2/3 and myosin-I linker protein 3 4.41e-04 NA 8.84e-06
3. B Q8VZG8 MDIS1-interacting receptor like kinase 2 5.57e-02 NA 0.047
3. B Q8BHB0 Nucleotide-binding oligomerization domain-containing protein 1 2.51e-07 NA 3.52e-12
3. B Q53B87 Nucleotide-binding oligomerization domain-containing protein 2 3.51e-07 NA 1.88e-13
3. B P79621 MHC class II transactivator 1.11e-03 NA 0.020
3. B O75864 Protein phosphatase 1 regulatory subunit 37 1.76e-07 NA 3.95e-11
3. B Q86W24 NACHT, LRR and PYD domains-containing protein 14 1.54e-06 NA 7.00e-10
3. B Q66X22 NACHT, LRR and PYD domains-containing protein 9B 1.95e-06 NA 4.95e-06
3. B Q8BU40 NACHT, LRR and PYD domains-containing protein 4A 4.43e-09 NA 7.86e-04
3. B O22476 Protein BRASSINOSTEROID INSENSITIVE 1 1.61e-02 NA 0.045
3. B Q9NX02 NACHT, LRR and PYD domains-containing protein 2 5.00e-08 NA 5.04e-08
3. B Q6NZL6 Tonsoku-like protein 6.42e-05 NA 0.015
3. B D4A523 NACHT, LRR and PYD domains-containing protein 3 1.43e-07 NA 1.00e-07
3. B P70566 Tropomodulin-2 1.61e-04 NA 2.13e-04
3. B Q8R4B8 NACHT, LRR and PYD domains-containing protein 3 3.69e-06 NA 1.07e-06