Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q14BP6
(Leucine-rich repeat-containing protein 74B) with a FATCAT P-Value: 0.0 and RMSD of 1.68 angstrom. The sequence alignment identity is 27.6%.
Structural alignment shown in left. Query protein Q0VAA2 colored as red in alignment, homolog Q14BP6 colored as blue.
Query protein Q0VAA2 is also shown in right top, homolog Q14BP6 showed in right bottom. They are colored based on secondary structures.
Q0VAA2 MHIQFPSKPTLPRACWEGRITAGSPGMP-PDEIEIEPVRQSSDKMLYCE---AESPPTVEKVKPAR---ENSETDLEIED----DEKFFTTGQKELYLEA 89 Q14BP6 --------------------------MKGPCE-----VQKNEDQ----EGEAAATGPQAETLEAERSWTADSHSALEAEGTHGLGERVMAT----LYLKS 61 Q0VAA2 CKLMGVVPVSYFIRNMEESYVNLNHHGLGPRGTKAIAIALVSNMAVTKLELEDN--CIMEEGVLSLVEMLQENYYLQEMNISNNHLGLEGARIISDFFER 187 Q14BP6 CRANSVVPVSCLLRQEGASELNLRHRGLGPQGVRALASVLTSNPYIKRLDLRDNGLC--GAGAEALADVLRKNSIISDVDLSENQIGAAGLQAICTALAL 159 Q0VAA2 NSSSIWSLELSGNDFKEDSAALLCQALSTNYQ-IKKLDLSHNQFSDVGGEHLGQMLAINVGLTSLDLSWNNFHTR--GAVALCNGLRGNVTLTKLDLSMN 284 Q14BP6 N-PTVEKMQLQGNRLEEQAAQHLA-ALLLHHRGLKSLDLSYNQLNDLAGEILGPAVAENTGLTELNLSWN--HLRGLGATAFARGLEANIFLKVLDISHN 255 Q0VAA2 GFGNEVALALGEVLRLNRCLVYLDIGGNDIGNEGASKISKGLESNESLRVLKLFLNPINMDGAILLILAIKRNPKSR-MEELDISNVLVS---EQF---M 377 Q14BP6 GFGDSGASAIGDALRVNNVLEELNMRNNRISVSGALKLGLGLQVNQTLRILIISKNPIRSDGCVGLLKSV-RNNKSSALELLDVSDIQVSRECEDLASSM 354 Q0VAA2 -KTLDGV----YAVH----PQLDVVFKAV-----QGLSPKKTIFLLTNPMKLIQSYADQHKITIVDFFKSLNPTGTMKMSVDEFQKVMIEQNKVPLNQYQ 463 Q14BP6 SEILPGLCIKRYTSRRKDWPQASTPSQPASAPSDSGL--------------------------------------------------------------- 391 Q0VAA2 VREVIKKLDEKTGMVNFSFLNTMKP 488 Q14BP6 ------------------------- 391
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0006954 | inflammatory response |
| 1. PB | GO:0036126 | sperm flagellum |
| 1. PB | GO:0032757 | positive regulation of interleukin-8 production |
| 1. PB | GO:0009524 | phragmoplast |
| 1. PB | GO:0045471 | response to ethanol |
| 1. PB | GO:0005096 | GTPase activator activity |
| 1. PB | GO:0071222 | cellular response to lipopolysaccharide |
| 1. PB | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 1. PB | GO:0032760 | positive regulation of tumor necrosis factor production |
| 1. PB | GO:0032495 | response to muramyl dipeptide |
| 1. PB | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
| 1. PB | GO:0014070 | response to organic cyclic compound |
| 1. PB | GO:0045087 | innate immune response |
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway |
| 1. PB | GO:0030317 | flagellated sperm motility |
| 2. P | GO:0010508 | positive regulation of autophagy |
| 2. P | GO:0014889 | muscle atrophy |
| 2. P | GO:0090141 | positive regulation of mitochondrial fission |
| 2. P | GO:0070848 | response to growth factor |
| 2. P | GO:0042994 | cytoplasmic sequestering of transcription factor |
| 2. P | GO:0005589 | collagen type VI trimer |
| 2. P | GO:0055046 | microgametogenesis |
| 2. P | GO:0032496 | response to lipopolysaccharide |
| 2. P | GO:0043202 | lysosomal lumen |
| 2. P | GO:0051216 | cartilage development |
| 2. P | GO:0006404 | RNA import into nucleus |
| 2. P | GO:0034612 | response to tumor necrosis factor |
| 2. P | GO:0010375 | stomatal complex patterning |
| 2. P | GO:0005201 | extracellular matrix structural constituent |
| 2. P | GO:0032914 | positive regulation of transforming growth factor beta1 production |
| 2. P | GO:0005796 | Golgi lumen |
| 2. P | GO:0001847 | opsonin receptor activity |
| 2. P | GO:0002237 | response to molecule of bacterial origin |
| 2. P | GO:0002718 | regulation of cytokine production involved in immune response |
| 2. P | GO:0070171 | negative regulation of tooth mineralization |
| 2. P | GO:0045121 | membrane raft |
| 2. P | GO:0001819 | positive regulation of cytokine production |
| 2. P | GO:0035307 | positive regulation of protein dephosphorylation |
| 2. P | GO:0010888 | negative regulation of lipid storage |
| 2. P | GO:0030021 | extracellular matrix structural constituent conferring compression resistance |
| 2. P | GO:0042567 | insulin-like growth factor ternary complex |
| 2. P | GO:0031430 | M band |
| 2. P | GO:0005576 | extracellular region |
| 2. P | GO:0032026 | response to magnesium ion |
| 2. P | GO:0007021 | tubulin complex assembly |
| 2. P | GO:0032729 | positive regulation of interferon-gamma production |
| 2. P | GO:0019903 | protein phosphatase binding |
| 2. P | GO:0010376 | stomatal complex formation |
| 2. P | GO:0072542 | protein phosphatase activator activity |
| 2. P | GO:0048495 | Roundabout binding |
| 2. P | GO:0070891 | lipoteichoic acid binding |
| 2. P | GO:0008330 | protein tyrosine/threonine phosphatase activity |
| 2. P | GO:0005615 | extracellular space |
| 2. P | GO:0009986 | cell surface |
| 2. P | GO:0050840 | extracellular matrix binding |
| 2. P | GO:0009897 | external side of plasma membrane |
| 2. P | GO:0009612 | response to mechanical stimulus |
| 2. P | GO:0014005 | microglia development |
| 2. P | GO:0004722 | protein serine/threonine phosphatase activity |
| 2. P | GO:0010745 | negative regulation of macrophage derived foam cell differentiation |
| 2. P | GO:0007059 | chromosome segregation |
| 2. P | GO:0071378 | cellular response to growth hormone stimulus |
| 2. P | GO:0016239 | positive regulation of macroautophagy |
| 2. P | GO:0035583 | sequestering of TGFbeta in extracellular matrix |
| 2. P | GO:0048936 | peripheral nervous system neuron axonogenesis |
| 2. P | GO:0030336 | negative regulation of cell migration |
| 2. P | GO:1904027 | negative regulation of collagen fibril organization |
| 2. P | GO:0009504 | cell plate |
| 2. P | GO:0070062 | extracellular exosome |
| 2. P | GO:0003341 | cilium movement |
| 2. P | GO:0001822 | kidney development |
| 2. P | GO:0017151 | DEAD/H-box RNA helicase binding |
| 2. P | GO:0010090 | trichome morphogenesis |
| 2. P | GO:0005520 | insulin-like growth factor binding |
| 2. P | GO:0010073 | meristem maintenance |
| 2. P | GO:0043231 | intracellular membrane-bounded organelle |
| 2. P | GO:0061975 | articular cartilage development |
| 2. P | GO:0071727 | cellular response to triacyl bacterial lipopeptide |
| 2. P | GO:0042383 | sarcolemma |
| 2. P | GO:0061303 | cornea development in camera-type eye |
| 2. P | GO:0071219 | cellular response to molecule of bacterial origin |
| 2. P | GO:0060348 | bone development |
| 2. P | GO:1905034 | regulation of antifungal innate immune response |
| 2. P | GO:0070427 | nucleotide-binding oligomerization domain containing 1 signaling pathway |
| 2. P | GO:0014068 | positive regulation of phosphatidylinositol 3-kinase signaling |
| 2. P | GO:1990727 | tubulin folding cofactor complex |
| 2. P | GO:0010596 | negative regulation of endothelial cell migration |
| 2. P | GO:0071726 | cellular response to diacyl bacterial lipopeptide |
| 2. P | GO:0007568 | aging |
| 2. P | GO:0030282 | bone mineralization |
| 2. P | GO:0000911 | cytokinesis by cell plate formation |
| 2. P | GO:0005614 | interstitial matrix |
| 2. P | GO:0034142 | toll-like receptor 4 signaling pathway |
| 2. P | GO:0098633 | collagen fibril binding |
| 2. P | GO:0030500 | regulation of bone mineralization |
| 2. P | GO:0036364 | transforming growth factor beta1 activation |
| 2. P | GO:0007601 | visual perception |
| 2. P | GO:1901222 | regulation of NIK/NF-kappaB signaling |
| 2. P | GO:0051901 | positive regulation of mitochondrial depolarization |
| 2. P | GO:0007023 | post-chaperonin tubulin folding pathway |
| 2. P | GO:0019834 | phospholipase A2 inhibitor activity |
| 2. P | GO:0071215 | cellular response to abscisic acid stimulus |
| 2. P | GO:0006898 | receptor-mediated endocytosis |
| 2. P | GO:0017017 | MAP kinase tyrosine/serine/threonine phosphatase activity |
| 2. P | GO:0018996 | molting cycle, collagen and cuticulin-based cuticle |
| 2. P | GO:0005518 | collagen binding |
| 2. P | GO:0031012 | extracellular matrix |
| 2. P | GO:0032481 | positive regulation of type I interferon production |
| 2. P | GO:0055008 | cardiac muscle tissue morphogenesis |
| 2. P | GO:0000226 | microtubule cytoskeleton organization |
| 2. P | GO:0071723 | lipopeptide binding |
| 2. P | GO:0019888 | protein phosphatase regulator activity |
| 2. P | GO:0005930 | axoneme |
| 2. P | GO:0005539 | glycosaminoglycan binding |
| 2. P | GO:0001530 | lipopolysaccharide binding |
| 2. P | GO:0001890 | placenta development |
| 2. P | GO:0008157 | protein phosphatase 1 binding |
| 2. P | GO:0007155 | cell adhesion |
| 2. P | GO:0007253 | cytoplasmic sequestering of NF-kappaB |
| 2. P | GO:0071223 | cellular response to lipoteichoic acid |
| 2. P | GO:0001974 | blood vessel remodeling |
| 2. P | GO:0031362 | anchored component of external side of plasma membrane |
| 2. P | GO:0043014 | alpha-tubulin binding |
| 2. P | GO:0016019 | peptidoglycan immune receptor activity |
| 2. P | GO:0009617 | response to bacterium |
| 2. P | GO:0006407 | rRNA export from nucleus |
| 2. P | GO:0019800 | peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan |
| 2. P | GO:0046696 | lipopolysaccharide receptor complex |
| 2. P | GO:0051602 | response to electrical stimulus |
| 2. P | GO:0031663 | lipopolysaccharide-mediated signaling pathway |
| 2. P | GO:0005583 | fibrillar collagen trimer |
| 2. P | GO:0046579 | positive regulation of Ras protein signal transduction |
| 2. P | GO:0031514 | motile cilium |
| 2. P | GO:0098868 | bone growth |
| 2. P | GO:0030199 | collagen fibril organization |
| 2. P | GO:0033256 | I-kappaB/NF-kappaB complex |
| 2. P | GO:0016525 | negative regulation of angiogenesis |
| 2. P | GO:0047485 | protein N-terminus binding |
| 2. P | GO:0006409 | tRNA export from nucleus |
| 2. P | GO:0006606 | protein import into nucleus |
| 2. P | GO:0007519 | skeletal muscle tissue development |
| 2. P | GO:0030133 | transport vesicle |
| 2. P | GO:0062023 | collagen-containing extracellular matrix |
| 2. P | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway |
| 2. P | GO:0042060 | wound healing |
| 2. P | GO:0000164 | protein phosphatase type 1 complex |
| 2. P | GO:0045807 | positive regulation of endocytosis |
| 2. P | GO:1900747 | negative regulation of vascular endothelial growth factor signaling pathway |
| 3. B | GO:0036336 | dendritic cell migration |
| 3. B | GO:0009729 | detection of brassinosteroid stimulus |
| 3. B | GO:0050680 | negative regulation of epithelial cell proliferation |
| 3. B | GO:0051656 | establishment of organelle localization |
| 3. B | GO:0002526 | acute inflammatory response |
| 3. B | GO:0045630 | positive regulation of T-helper 2 cell differentiation |
| 3. B | GO:0044319 | wound healing, spreading of cells |
| 3. B | GO:0036312 | phosphatidylinositol 3-kinase regulatory subunit binding |
| 3. B | GO:0045111 | intermediate filament cytoskeleton |
| 3. B | GO:0032701 | negative regulation of interleukin-18 production |
| 3. B | GO:0072559 | NLRP3 inflammasome complex |
| 3. B | GO:0009595 | detection of biotic stimulus |
| 3. B | GO:0032720 | negative regulation of tumor necrosis factor production |
| 3. B | GO:0044351 | macropinocytosis |
| 3. B | GO:1900140 | regulation of seedling development |
| 3. B | GO:0032755 | positive regulation of interleukin-6 production |
| 3. B | GO:0051639 | actin filament network formation |
| 3. B | GO:0002925 | positive regulation of humoral immune response mediated by circulating immunoglobulin |
| 3. B | GO:0010942 | positive regulation of cell death |
| 3. B | GO:0031953 | negative regulation of protein autophosphorylation |
| 3. B | GO:0072558 | NLRP1 inflammasome complex |
| 3. B | GO:0043549 | regulation of kinase activity |
| 3. B | GO:0030016 | myofibril |
| 3. B | GO:2000553 | positive regulation of T-helper 2 cell cytokine production |
| 3. B | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0071345 | cellular response to cytokine stimulus |
| 3. B | GO:0048147 | negative regulation of fibroblast proliferation |
| 3. B | GO:0031297 | replication fork processing |
| 3. B | GO:0031965 | nuclear membrane |
| 3. B | GO:0060471 | cortical granule exocytosis |
| 3. B | GO:0032733 | positive regulation of interleukin-10 production |
| 3. B | GO:0060340 | positive regulation of type I interferon-mediated signaling pathway |
| 3. B | GO:0032879 | regulation of localization |
| 3. B | GO:0030032 | lamellipodium assembly |
| 3. B | GO:0002710 | negative regulation of T cell mediated immunity |
| 3. B | GO:0032498 | detection of muramyl dipeptide |
| 3. B | GO:0071224 | cellular response to peptidoglycan |
| 3. B | GO:0007270 | neuron-neuron synaptic transmission |
| 3. B | GO:0044877 | protein-containing complex binding |
| 3. B | GO:1904417 | positive regulation of xenophagy |
| 3. B | GO:0043552 | positive regulation of phosphatidylinositol 3-kinase activity |
| 3. B | GO:0030426 | growth cone |
| 3. B | GO:0042834 | peptidoglycan binding |
| 3. B | GO:0045751 | negative regulation of Toll signaling pathway |
| 3. B | GO:0032754 | positive regulation of interleukin-5 production |
| 3. B | GO:0035101 | FACT complex |
| 3. B | GO:0002732 | positive regulation of dendritic cell cytokine production |
| 3. B | GO:1900016 | negative regulation of cytokine production involved in inflammatory response |
| 3. B | GO:0004864 | protein phosphatase inhibitor activity |
| 3. B | GO:0016500 | protein-hormone receptor activity |
| 3. B | GO:0030838 | positive regulation of actin filament polymerization |
| 3. B | GO:0002830 | positive regulation of type 2 immune response |
| 3. B | GO:0140297 | DNA-binding transcription factor binding |
| 3. B | GO:0061851 | leading edge of lamellipodium |
| 3. B | GO:0140608 | cysteine-type endopeptidase activator activity |
| 3. B | GO:1900029 | positive regulation of ruffle assembly |
| 3. B | GO:0010592 | positive regulation of lamellipodium assembly |
| 3. B | GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation |
| 3. B | GO:0090091 | positive regulation of extracellular matrix disassembly |
| 3. B | GO:0042110 | T cell activation |
| 3. B | GO:0007163 | establishment or maintenance of cell polarity |
| 3. B | GO:0050871 | positive regulation of B cell activation |
| 3. B | GO:2000363 | positive regulation of prostaglandin-E synthase activity |
| 3. B | GO:0046645 | positive regulation of gamma-delta T cell activation |
| 3. B | GO:0051293 | establishment of spindle localization |
| 3. B | GO:0032494 | response to peptidoglycan |
| 3. B | GO:0002227 | innate immune response in mucosa |
| 3. B | GO:0050766 | positive regulation of phagocytosis |
| 3. B | GO:0051496 | positive regulation of stress fiber assembly |
| 3. B | GO:0070269 | pyroptosis |
| 3. B | GO:1901223 | negative regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0030011 | maintenance of cell polarity |
| 3. B | GO:0016323 | basolateral plasma membrane |
| 3. B | GO:0032753 | positive regulation of interleukin-4 production |
| 3. B | GO:1990723 | cytoplasmic periphery of the nuclear pore complex |
| 3. B | GO:0030277 | maintenance of gastrointestinal epithelium |
| 3. B | GO:0046415 | urate metabolic process |
| 3. B | GO:2000321 | positive regulation of T-helper 17 cell differentiation |
| 3. B | GO:0030544 | Hsp70 protein binding |
| 3. B | GO:0002862 | negative regulation of inflammatory response to antigenic stimulus |
| 3. B | GO:0048657 | anther wall tapetum cell differentiation |
| 3. B | GO:0050700 | CARD domain binding |
| 3. B | GO:0060339 | negative regulation of type I interferon-mediated signaling pathway |
| 3. B | GO:0016235 | aggresome |
| 3. B | GO:0051770 | positive regulation of nitric-oxide synthase biosynthetic process |
| 3. B | GO:0045765 | regulation of angiogenesis |
| 3. B | GO:0045345 | positive regulation of MHC class I biosynthetic process |
| 3. B | GO:0031252 | cell leading edge |
| 3. B | GO:0045089 | positive regulation of innate immune response |
| 3. B | GO:0005865 | striated muscle thin filament |
| 3. B | GO:0051694 | pointed-end actin filament capping |
| 3. B | GO:0006936 | muscle contraction |
| 3. B | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0009755 | hormone-mediated signaling pathway |
| 3. B | GO:0006913 | nucleocytoplasmic transport |
| 3. B | GO:0019966 | interleukin-1 binding |
| 3. B | GO:0051353 | positive regulation of oxidoreductase activity |
| 3. B | GO:0089720 | caspase binding |
| 3. B | GO:0005856 | cytoskeleton |
| 3. B | GO:0045824 | negative regulation of innate immune response |
| 3. B | GO:0061339 | establishment or maintenance of monopolar cell polarity |
| 3. B | GO:0034315 | regulation of Arp2/3 complex-mediated actin nucleation |
| 3. B | GO:0009934 | regulation of meristem structural organization |
| 3. B | GO:0043124 | negative regulation of I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0005635 | nuclear envelope |
| 3. B | GO:0008656 | cysteine-type endopeptidase activator activity involved in apoptotic process |
| 3. B | GO:0039536 | negative regulation of RIG-I signaling pathway |
| 3. B | GO:0061702 | inflammasome complex |
| 3. B | GO:0071225 | cellular response to muramyl dipeptide |
| 3. B | GO:0007015 | actin filament organization |
| 3. B | GO:0060473 | cortical granule |
| 3. B | GO:0032661 | regulation of interleukin-18 production |
| 3. B | GO:0002606 | positive regulation of dendritic cell antigen processing and presentation |
| 3. B | GO:0045745 | positive regulation of G protein-coupled receptor signaling pathway |
| 3. B | GO:0048678 | response to axon injury |
| 3. B | GO:0030239 | myofibril assembly |
| 3. B | GO:0002674 | negative regulation of acute inflammatory response |
| 3. B | GO:0044546 | NLRP3 inflammasome complex assembly |
| 3. B | GO:0038187 | pattern recognition receptor activity |
| 3. B | GO:0031529 | ruffle organization |
| 3. B | GO:0098641 | cadherin binding involved in cell-cell adhesion |
| 3. B | GO:0016715 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced ascorbate as one donor, and incorporation of one atom of oxygen |
| 3. B | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0002720 | positive regulation of cytokine production involved in immune response |
| 3. B | GO:0046330 | positive regulation of JNK cascade |
| 3. B | GO:0050728 | negative regulation of inflammatory response |
| 3. B | GO:0043281 | regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:1904784 | NLRP1 inflammasome complex assembly |
| 3. B | GO:0014067 | negative regulation of phosphatidylinositol 3-kinase signaling |
| 3. B | GO:1905246 | negative regulation of aspartic-type peptidase activity |
| 3. B | GO:0005523 | tropomyosin binding |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:0010305 | leaf vascular tissue pattern formation |
| 3. B | GO:0044614 | nuclear pore cytoplasmic filaments |
| 3. B | GO:0032735 | positive regulation of interleukin-12 production |
| 3. B | GO:0046597 | negative regulation of viral entry into host cell |
| 3. B | GO:0070374 | positive regulation of ERK1 and ERK2 cascade |
| 3. B | GO:0034136 | negative regulation of toll-like receptor 2 signaling pathway |
| 3. B | GO:0032715 | negative regulation of interleukin-6 production |
| 3. B | GO:0007611 | learning or memory |
| 3. B | GO:0050679 | positive regulation of epithelial cell proliferation |
| 3. B | GO:0008428 | ribonuclease inhibitor activity |
| 3. B | GO:0032692 | negative regulation of interleukin-1 production |
| 3. B | GO:0009968 | negative regulation of signal transduction |
| 3. B | GO:0043596 | nuclear replication fork |
| 3. B | GO:0006887 | exocytosis |
| 3. B | GO:0071639 | positive regulation of monocyte chemotactic protein-1 production |
| 3. B | GO:1901992 | positive regulation of mitotic cell cycle phase transition |
| 3. B | GO:0036064 | ciliary basal body |
| 3. B | GO:0043122 | regulation of I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0032687 | negative regulation of interferon-alpha production |
| 3. B | GO:0009956 | radial pattern formation |
| 3. B | GO:0046826 | negative regulation of protein export from nucleus |
| 3. B | GO:0009825 | multidimensional cell growth |
| 3. B | GO:0030335 | positive regulation of cell migration |
| 3. B | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0009933 | meristem structural organization |
| 3. B | GO:0045348 | positive regulation of MHC class II biosynthetic process |
| 3. B | GO:0060335 | positive regulation of interferon-gamma-mediated signaling pathway |
| 3. B | GO:0051879 | Hsp90 protein binding |
| 3. B | GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0051000 | positive regulation of nitric-oxide synthase activity |
| 3. B | GO:1900026 | positive regulation of substrate adhesion-dependent cell spreading |
| 3. B | GO:0051607 | defense response to virus |
| 3. B | GO:0002523 | leukocyte migration involved in inflammatory response |
| 3. B | GO:0072423 | response to DNA damage checkpoint signaling |
| 3. B | GO:0042393 | histone binding |
| 3. B | GO:0002253 | activation of immune response |
| 3. B | GO:0032731 | positive regulation of interleukin-1 beta production |
| 3. B | GO:1902523 | positive regulation of protein K63-linked ubiquitination |
| 3. B | GO:0032741 | positive regulation of interleukin-18 production |
| 3. B | GO:0070373 | negative regulation of ERK1 and ERK2 cascade |
| 3. B | GO:0032689 | negative regulation of interferon-gamma production |
| 3. B | GO:0002221 | pattern recognition receptor signaling pathway |
| 3. B | GO:0032703 | negative regulation of interleukin-2 production |
| 3. B | GO:0032695 | negative regulation of interleukin-12 production |
| 3. B | GO:2000813 | negative regulation of barbed-end actin filament capping |
| 3. B | GO:0007584 | response to nutrient |
| 3. B | GO:0032311 | angiogenin-PRI complex |
| 3. B | GO:2000110 | negative regulation of macrophage apoptotic process |
| 3. B | GO:1900017 | positive regulation of cytokine production involved in inflammatory response |
| 3. B | GO:0017024 | myosin I binding |
| 3. B | GO:0043330 | response to exogenous dsRNA |
| 3. B | GO:0005814 | centriole |
| 3. B | GO:0010584 | pollen exine formation |
| 3. B | GO:0000724 | double-strand break repair via homologous recombination |
| 3. B | GO:0090022 | regulation of neutrophil chemotaxis |
| 3. B | GO:0006919 | activation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0032736 | positive regulation of interleukin-13 production |
| 3. B | GO:0034341 | response to interferon-gamma |
| 3. B | GO:0042585 | germinal vesicle |
| 3. B | GO:0043487 | regulation of RNA stability |
| 3. B | GO:0051638 | barbed-end actin filament uncapping |
| 3. B | GO:0106333 | subcortical maternal complex |
| 3. B | GO:1902745 | positive regulation of lamellipodium organization |
| 3. B | GO:0042981 | regulation of apoptotic process |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:1904115 | axon cytoplasm |
| 3. B | GO:0051302 | regulation of cell division |
| 3. B | GO:0010268 | brassinosteroid homeostasis |
| 3. B | GO:0045747 | positive regulation of Notch signaling pathway |
| 3. B | GO:0006915 | apoptotic process |
| 3. B | GO:0005813 | centrosome |
| 3. B | GO:0070685 | macropinocytic cup |
| 3. B | GO:0006963 | positive regulation of antibacterial peptide biosynthetic process |
| 3. B | GO:0005829 | cytosol |
| 3. B | GO:0032740 | positive regulation of interleukin-17 production |
| 3. B | GO:0032691 | negative regulation of interleukin-1 beta production |
| 3. B | GO:0003779 | actin binding |
| 3. B | GO:0043406 | positive regulation of MAP kinase activity |
| 3. B | GO:0040019 | positive regulation of embryonic development |
| 3. B | GO:0032090 | Pyrin domain binding |
| 3. B | GO:0042555 | MCM complex |
| 3. B | GO:0001818 | negative regulation of cytokine production |
| 3. B | GO:0032688 | negative regulation of interferon-beta production |
| 3. B | GO:0031982 | vesicle |
| 3. B | GO:0010540 | basipetal auxin transport |
| 3. B | GO:0060585 | positive regulation of prostaglandin-endoperoxide synthase activity |
| 3. B | GO:0035556 | intracellular signal transduction |
| 3. B | GO:0015631 | tubulin binding |
| 3. B | GO:0050727 | regulation of inflammatory response |
| 3. B | GO:0046658 | anchored component of plasma membrane |
| 3. B | GO:0032874 | positive regulation of stress-activated MAPK cascade |
| 3. B | GO:0072557 | IPAF inflammasome complex |
| 3. B | GO:0016045 | detection of bacterium |
| 3. B | GO:0044782 | cilium organization |
| 3. B | GO:0042742 | defense response to bacterium |
| 3. B | GO:0071407 | cellular response to organic cyclic compound |
| 3. B | GO:0045335 | phagocytic vesicle |
| 3. B | GO:0006965 | positive regulation of biosynthetic process of antibacterial peptides active against Gram-positive bacteria |
| 3. B | GO:1904117 | cellular response to vasopressin |
| 3. B | GO:0044354 | macropinosome |
| 3. B | GO:0005662 | DNA replication factor A complex |
| 3. B | GO:0050830 | defense response to Gram-positive bacterium |
| 3. B | GO:0032500 | muramyl dipeptide binding |
| 3. B | GO:0031941 | filamentous actin |
| 3. B | GO:1900226 | negative regulation of NLRP3 inflammasome complex assembly |
| 3. B | GO:0005654 | nucleoplasm |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q9LE82 | RAN GTPase-activating protein 1 | 2.62e-08 | 2.37e-12 | 2.04e-09 |
| 1. PB | A8HMZ4 | Dynein regulatory complex subunit 5 | 1.35e-10 | 3.53e-04 | 1.73e-19 |
| 1. PB | Q9DAM1 | Leucine-rich repeat-containing protein 34 | 1.67e-15 | 3.79e-08 | 3.98e-13 |
| 1. PB | Q0VAA2 | Leucine-rich repeat-containing protein 74A | 0 | 2.67e-140 | 0.0 |
| 1. PB | Q9M651 | RAN GTPase-activating protein 2 | 1.90e-07 | 3.99e-08 | 1.08e-14 |
| 1. PB | A0JPI9 | Leucine-rich repeat-containing protein 74A | 0.00e+00 | 2.64e-43 | 0.0 |
| 1. PB | Q9D3W5 | Leucine-rich repeat-containing protein 71 | 2.06e-03 | 9.53e-05 | 6.73e-05 |
| 1. PB | Q14BP6 | Leucine-rich repeat-containing protein 74B | 0.00e+00 | 1.87e-14 | 6.77e-61 |
| 1. PB | Q8IZ02 | Leucine-rich repeat-containing protein 34 | 3.40e-11 | 5.66e-16 | 1.04e-13 |
| 1. PB | Q6ZQY2 | Leucine-rich repeat-containing protein 74B | 3.33e-16 | 1.78e-17 | 1.58e-62 |
| 1. PB | Q1L994 | Protein phosphatase 1 regulatory subunit 37 | 8.18e-08 | 4.08e-06 | 5.70e-08 |
| 1. PB | Q8N4P6 | Leucine-rich repeat-containing protein 71 | 6.62e-04 | 2.73e-05 | 7.81e-06 |
| 1. PB | Q4V8D9 | Leucine-rich repeat-containing protein 34 | 1.11e-15 | 8.28e-07 | 6.83e-14 |
| 2. P | Q6PEZ8 | Podocan-like protein 1 | 2.24e-04 | 3.61e-03 | NA |
| 2. P | Q3ZBN5 | Asporin | 3.79e-05 | 5.24e-03 | NA |
| 2. P | Q9Y546 | Leucine-rich repeat-containing protein 42 | 1.60e-02 | 1.06e-09 | NA |
| 2. P | Q65YW8 | Tsukushi-A | 2.80e-03 | 9.87e-03 | NA |
| 2. P | P28653 | Biglycan | 7.62e-05 | 1.01e-04 | NA |
| 2. P | O46542 | Decorin | 7.60e-04 | 2.06e-04 | NA |
| 2. P | Q9BYS8 | Leucine-rich repeat-containing protein 2 | 1.81e-03 | 3.92e-03 | NA |
| 2. P | P58823 | Polygalacturonase inhibitor 3 | 1.78e-03 | 3.65e-02 | NA |
| 2. P | Q9SJH6 | Receptor like protein 29 | 1.31e-03 | 4.36e-02 | NA |
| 2. P | Q8AVI4 | Leucine-rich repeat protein SHOC-2 | 1.25e-03 | 2.75e-02 | NA |
| 2. P | Q6P5J6 | Leucine-rich repeat-containing protein 42 | 6.06e-03 | 2.19e-07 | NA |
| 2. P | B4IBI9 | Leucine-rich repeat protein soc-2 homolog | 1.34e-03 | 3.97e-02 | NA |
| 2. P | A2RTY3 | Protein HEATR9 | 8.79e-02 | 1.30e-02 | NA |
| 2. P | Q5RAV5 | Leucine-rich repeat protein SHOC-2 | 3.58e-03 | 2.04e-02 | NA |
| 2. P | Q7XK44 | Plant intracellular Ras-group-related LRR protein 3 | 9.30e-04 | 2.21e-02 | NA |
| 2. P | A6NHZ5 | Leucine-rich repeat-containing protein 14B | 3.71e-05 | 5.65e-04 | NA |
| 2. P | Q5HZV9 | Protein phosphatase 1 regulatory subunit 7 | 2.14e-04 | 3.76e-03 | NA |
| 2. P | Q5FVQ9 | Tubulin-specific chaperone E | 3.18e-04 | 3.32e-02 | NA |
| 2. P | P02750 | Leucine-rich alpha-2-glycoprotein | 7.97e-04 | 1.18e-07 | NA |
| 2. P | Q9DE68 | Decorin | 1.04e-04 | 7.55e-06 | NA |
| 2. P | Q9CQ76 | Nephrocan | 3.77e-04 | 1.88e-04 | NA |
| 2. P | Q9LRV8 | Plant intracellular Ras-group-related LRR protein 2 | 8.71e-04 | 1.62e-04 | NA |
| 2. P | P51885 | Lumican | 3.74e-05 | 3.45e-02 | NA |
| 2. P | Q9UQ13 | Leucine-rich repeat protein SHOC-2 | 7.09e-03 | 2.04e-02 | NA |
| 2. P | O93233 | Phospholipase A2 inhibitor | 7.40e-05 | 3.54e-03 | NA |
| 2. P | P51884 | Lumican | 2.18e-04 | 5.34e-03 | NA |
| 2. P | O88520 | Leucine-rich repeat protein SHOC-2 | 7.00e-04 | 1.20e-02 | NA |
| 2. P | A6NM36 | Leucine-rich repeat-containing protein 30 | 6.70e-05 | 1.07e-05 | NA |
| 2. P | Q9XSD9 | Decorin | 8.50e-05 | 8.59e-06 | NA |
| 2. P | Q6AYI5 | Leucine-rich repeat protein SHOC-2 | 1.05e-03 | 1.07e-02 | NA |
| 2. P | Q587K4 | Leucine-rich repeat-containing protein 73 | 1.16e-10 | 2.58e-03 | NA |
| 2. P | Q5RFS7 | Protein phosphatase 1 regulatory subunit 7 | 3.28e-05 | 2.86e-03 | NA |
| 2. P | P07585 | Decorin | 1.28e-04 | 1.36e-04 | NA |
| 2. P | Q3UM45 | Protein phosphatase 1 regulatory subunit 7 | 1.32e-04 | 6.21e-03 | NA |
| 2. P | Q28680 | Monocyte differentiation antigen CD14 | 6.06e-05 | 2.11e-03 | NA |
| 2. P | F1R6I3 | Leucine-rich repeat-containing protein 39 | 5.03e-04 | 6.03e-05 | NA |
| 2. P | P70389 | Insulin-like growth factor-binding protein complex acid labile subunit | 3.92e-03 | 4.30e-05 | NA |
| 2. P | Q8W4Q3 | Plant intracellular Ras-group-related LRR protein 3 | 8.38e-04 | 6.29e-04 | NA |
| 2. P | Q9SHI4 | Receptor-like protein 3 | 6.29e-03 | 3.38e-02 | NA |
| 2. P | Q6C417 | U2 small nuclear ribonucleoprotein A' | 1.36e-02 | 3.01e-04 | NA |
| 2. P | Q8TBY9 | Cilia- and flagella-associated protein 251 | 9.13e-01 | 2.24e-03 | NA |
| 2. P | Q3UV48 | Leucine-rich repeat-containing protein 30 | 3.28e-04 | 1.86e-02 | NA |
| 2. P | Q7Z5L7 | Podocan | 1.46e-03 | 7.63e-05 | NA |
| 2. P | Q95122 | Monocyte differentiation antigen CD14 | 7.61e-04 | 1.70e-03 | NA |
| 2. P | B3P3E8 | Leucine-rich repeat protein soc-2 homolog | 5.26e-04 | 8.11e-03 | NA |
| 2. P | O42235 | Keratocan | 1.27e-05 | 2.55e-02 | NA |
| 2. P | Q9IB75 | Biglycan | 2.47e-04 | 4.47e-04 | NA |
| 2. P | P36047 | Protein phosphatase 1 regulatory subunit SDS22 | 6.89e-05 | 1.55e-02 | NA |
| 2. P | Q7TQ62 | Podocan | 1.45e-03 | 1.90e-03 | NA |
| 2. P | Q9LUI1 | Leucine-rich repeat extensin-like protein 6 | 2.05e-03 | 4.44e-02 | NA |
| 2. P | P21810 | Biglycan | 4.02e-05 | 8.15e-05 | NA |
| 2. P | Q4R6F0 | Leucine-rich repeat and death domain-containing protein 1 | 5.55e-03 | 4.35e-05 | NA |
| 2. P | P08571 | Monocyte differentiation antigen CD14 | 5.00e-04 | 3.18e-06 | NA |
| 2. P | O46403 | Biglycan | 2.62e-04 | 2.73e-04 | NA |
| 2. P | O02833 | Insulin-like growth factor-binding protein complex acid labile subunit | 1.10e-03 | 4.98e-03 | NA |
| 2. P | O62702 | Keratocan | 3.15e-06 | 2.77e-02 | NA |
| 2. P | Q9Z1S7 | Osteomodulin | 2.43e-05 | 2.79e-06 | NA |
| 2. P | D3ZXS4 | Leucine-rich repeat-containing protein 39 | 6.04e-04 | 7.89e-05 | NA |
| 2. P | Q53EV4 | Leucine-rich repeat-containing protein 23 | 2.33e-04 | 4.32e-02 | NA |
| 2. P | O02678 | Biglycan | 2.09e-04 | 2.39e-04 | NA |
| 2. P | Q9TTE2 | Decorin | 8.75e-05 | 5.51e-05 | NA |
| 2. P | P11745 | Ran GTPase-activating protein 1 | 3.82e-12 | 7.89e-05 | NA |
| 2. P | P47853 | Biglycan | 1.33e-04 | 7.80e-05 | NA |
| 2. P | Q1L8H0 | Leucine-rich repeat-containing protein 14B | 7.28e-05 | 7.93e-04 | NA |
| 2. P | Q3UJB3 | Leucine-rich repeat-containing protein 14B | 1.54e-05 | 3.75e-05 | NA |
| 2. P | Q54Y32 | MAP kinase phosphatase with leucine-rich repeats protein 3 | 8.94e-02 | 2.13e-03 | NA |
| 2. P | Q5R1V9 | Decorin | 2.26e-04 | 1.36e-04 | NA |
| 2. P | P28654 | Decorin | 9.79e-05 | 3.84e-05 | NA |
| 2. P | Q28CU0 | Leucine-rich repeat-containing protein 23 | 2.38e-04 | 3.02e-02 | NA |
| 2. P | B3LWU3 | Leucine-rich repeat protein soc-2 homolog | 1.37e-03 | 2.88e-02 | NA |
| 2. P | Q4KLV2 | Leucine-rich repeat-containing protein 42 | 7.80e-02 | 7.41e-07 | NA |
| 2. P | Q9U3A0 | P-granule-associated novel protein 1 | 2.95e-03 | 3.97e-02 | NA |
| 2. P | B4QVR7 | Leucine-rich repeat protein soc-2 homolog | 1.28e-03 | 1.43e-02 | NA |
| 2. P | P10810 | Monocyte differentiation antigen CD14 | 5.36e-05 | 1.56e-02 | NA |
| 2. P | Q99983 | Osteomodulin | 2.48e-05 | 3.03e-05 | NA |
| 2. P | Q15435 | Protein phosphatase 1 regulatory subunit 7 | 5.30e-05 | 9.28e-04 | NA |
| 2. P | Q2HJ90 | Leucine-rich repeat-containing protein 42 | 4.92e-02 | 1.97e-11 | NA |
| 2. P | Q96DD0 | Leucine-rich repeat-containing protein 39 | 6.70e-04 | 5.73e-03 | NA |
| 2. P | O64566 | Plant intracellular Ras-group-related LRR protein 6 | 3.07e-04 | 2.36e-03 | NA |
| 2. P | O60938 | Keratocan | 2.67e-05 | 2.61e-03 | NA |
| 2. P | P35859 | Insulin-like growth factor-binding protein complex acid labile subunit | 5.60e-04 | 1.60e-03 | NA |
| 2. P | Q29393 | Decorin | 2.89e-05 | 5.62e-06 | NA |
| 2. P | Q8LB33 | F-box protein At3g58530 | 3.95e-05 | 1.08e-02 | NA |
| 2. P | Q8C0R9 | Leucine-rich repeat and death domain-containing protein 1 | 8.05e-03 | 1.08e-04 | NA |
| 2. P | O77742 | Osteomodulin | 7.98e-04 | 5.77e-04 | NA |
| 2. P | Q4KM95 | Leucine-rich repeat-containing protein 42 | 6.67e-03 | 1.65e-09 | NA |
| 2. P | O35367 | Keratocan | 2.19e-05 | 3.65e-02 | NA |
| 2. P | Q8BGI7 | Leucine-rich repeat-containing protein 39 | 3.20e-04 | 1.26e-03 | NA |
| 2. P | P51886 | Lumican | 5.96e-05 | 2.52e-02 | NA |
| 2. P | Q54Q39 | Protein phosphatase 1 regulatory subunit pprA | 3.36e-05 | 2.33e-03 | NA |
| 2. P | C0STK7 | Phospholipase A2 inhibitor beta | NA | 4.16e-03 | NA |
| 2. P | Q55CN0 | Tubulin-specific chaperone E | 1.06e-03 | 1.21e-03 | NA |
| 2. P | Q5JTD7 | Leucine-rich repeat-containing protein 73 | 1.23e-14 | 2.69e-03 | NA |
| 2. P | P25963 | NF-kappa-B inhibitor alpha | 4.05e-01 | 3.38e-02 | NA |
| 2. P | Q9SSD1 | Protein TOO MANY MOUTHS | 2.03e-03 | 3.30e-03 | NA |
| 2. P | A6QLV3 | Leucine-rich repeat protein SHOC-2 | 1.27e-03 | 3.17e-02 | NA |
| 2. P | Q8R2U7 | Leucine-rich repeat-containing protein 42 | 6.35e-02 | 1.78e-10 | NA |
| 2. P | P21809 | Biglycan | 1.91e-04 | 2.22e-04 | NA |
| 2. P | O35103 | Osteomodulin | 1.62e-03 | 6.45e-05 | NA |
| 2. P | Q99MQ4 | Asporin | 2.47e-05 | 3.79e-02 | NA |
| 2. P | Q01129 | Decorin | 1.58e-04 | 2.61e-04 | NA |
| 2. P | P41391 | Ran GTPase-activating protein 1 | 1.23e-09 | 1.28e-04 | NA |
| 2. P | P28675 | Decorin | 2.32e-04 | 1.55e-04 | NA |
| 2. P | Q9FFJ3 | Plant intracellular Ras-group-related LRR protein 1 | 8.37e-03 | 1.99e-02 | NA |
| 2. P | B4LXW1 | Leucine-rich repeat protein soc-2 homolog | 5.38e-04 | 3.61e-03 | NA |
| 2. P | Q3ZC49 | Leucine-rich repeat-containing protein 39 | 3.75e-04 | 2.85e-04 | NA |
| 2. P | Q10303 | Cell polarity protein alp21 | 3.62e-04 | 2.15e-03 | NA |
| 2. P | A4D1F6 | Leucine-rich repeat and death domain-containing protein 1 | 7.57e-03 | 7.85e-04 | NA |
| 2. P | O46390 | Biglycan | 2.94e-03 | 5.76e-05 | NA |
| 2. P | Q6AXL3 | Transforming growth factor beta activator LRRC33 | 8.13e-04 | 4.24e-03 | NA |
| 2. P | Q3T0W4 | Protein phosphatase 1 regulatory subunit 7 | 1.26e-04 | 3.17e-03 | NA |
| 2. P | Q5RE88 | Cilia- and flagella-associated protein 251 | 9.02e-01 | 4.51e-03 | NA |
| 2. P | A7SFP1 | Leucine-rich repeat protein soc-2 homolog | 3.20e-03 | 1.91e-02 | NA |
| 2. P | Q9DE66 | Keratocan | 4.76e-05 | 2.19e-02 | NA |
| 2. P | Q0V9Y8 | Leucine-rich repeat-containing protein 42 | 1.41e-02 | 2.96e-10 | NA |
| 2. P | P35858 | Insulin-like growth factor-binding protein complex acid labile subunit | 1.09e-03 | 9.31e-03 | NA |
| 2. P | Q6UY01 | Leucine-rich repeat-containing protein 31 | 1.43e-06 | 3.55e-08 | NA |
| 2. P | Q5F4C4 | Leucine-rich repeat protein SHOC-2 | 4.68e-04 | 4.19e-04 | NA |
| 2. P | Q05443 | Lumican | 2.51e-04 | 2.42e-04 | NA |
| 2. P | Q63691 | Monocyte differentiation antigen CD14 | 5.23e-04 | 7.49e-03 | NA |
| 2. P | P21793 | Decorin | 5.86e-05 | 1.87e-05 | NA |
| 2. P | Q6ZH85 | Plant intracellular Ras-group-related LRR protein 2 | 1.28e-03 | 5.73e-03 | NA |
| 2. P | Q8VDB8 | Leucine-rich repeat-containing protein 2 | 1.03e-03 | 3.88e-05 | NA |
| 2. P | Q28888 | Decorin | 6.44e-05 | 2.56e-04 | NA |
| 3. B | Q6IRU7 | Centrosomal protein of 78 kDa | 1.91e-04 | NA | 3.29e-04 |
| 3. B | C6FG12 | Protein NLRC5 | 7.93e-03 | NA | 1.05e-08 |
| 3. B | Q5VZK9 | F-actin-uncapping protein LRRC16A | 4.09e-04 | NA | 3.35e-07 |
| 3. B | Q66X19 | NACHT, LRR and PYD domains-containing protein 4E | 2.12e-05 | NA | 3.13e-04 |
| 3. B | P10775 | Ribonuclease inhibitor | 6.50e-10 | NA | 3.62e-09 |
| 3. B | A6QLE5 | NACHT, LRR and PYD domains-containing protein 3 | 3.73e-06 | NA | 1.85e-09 |
| 3. B | A6H639 | Dynein regulatory complex subunit 5 | 1.51e-05 | NA | 1.17e-13 |
| 3. B | Q86WI3 | Protein NLRC5 | 3.18e-03 | NA | 4.32e-14 |
| 3. B | P0CD60 | FERM domain-containing protein C | 6.50e-05 | NA | 4.35e-12 |
| 3. B | Q96P20 | NACHT, LRR and PYD domains-containing protein 3 | 1.21e-07 | NA | 1.44e-07 |
| 3. B | Q8WX94 | NACHT, LRR and PYD domains-containing protein 7 | 2.96e-05 | NA | 9.08e-06 |
| 3. B | Q3TL44 | NLR family member X1 | 1.20e-03 | NA | 3.10e-04 |
| 3. B | Q9Y239 | Nucleotide-binding oligomerization domain-containing protein 1 | 2.18e-07 | NA | 3.99e-13 |
| 3. B | A9JR78 | Tonsoku-like protein | 4.19e-05 | NA | 6.04e-05 |
| 3. B | A8Y3R9 | Protein phosphatase 1 regulatory subunit 37 homolog | 2.19e-07 | NA | 1.99e-12 |
| 3. B | Q96CN5 | Leucine-rich repeat-containing protein 45 | 7.79e-05 | NA | 3.05e-16 |
| 3. B | Q9C000 | NACHT, LRR and PYD domains-containing protein 1 | 4.59e-03 | NA | 1.79e-05 |
| 3. B | Q5DU56 | Protein NLRC3 | 9.80e-07 | NA | 1.45e-28 |
| 3. B | Q5JU00 | Dynein regulatory complex subunit 5 | 6.63e-07 | NA | 2.78e-13 |
| 3. B | A7Z026 | Protein phosphatase 1 regulatory subunit 37 | 3.12e-09 | NA | 2.21e-11 |
| 3. B | Q53B88 | Nucleotide-binding oligomerization domain-containing protein 2 | 3.19e-07 | NA | 1.63e-13 |
| 3. B | P33076 | MHC class II transactivator | 1.73e-03 | NA | 0.004 |
| 3. B | C3VPR6 | Protein NLRC5 | 1.36e-03 | NA | 7.73e-10 |
| 3. B | Q3UFQ8 | Capping protein, Arp2/3 and myosin-I linker protein 3 | 5.51e-04 | NA | 1.31e-05 |
| 3. B | Q6B966 | NACHT, LRR and PYD domains-containing protein 14 | 7.16e-07 | NA | 1.97e-04 |
| 3. B | P59045 | NACHT, LRR and PYD domains-containing protein 11 | 1.70e-07 | NA | 1.79e-06 |
| 3. B | Q9R1M5 | NACHT, LRR and PYD domains-containing protein 5 | 1.07e-05 | NA | 9.48e-09 |
| 3. B | Q6EDY6 | F-actin-uncapping protein LRRC16A | 3.98e-04 | NA | 9.44e-07 |
| 3. B | P13489 | Ribonuclease inhibitor | 1.31e-09 | NA | 3.84e-08 |
| 3. B | Q0VC48 | Tropomodulin-4 | 2.68e-04 | NA | 2.87e-04 |
| 3. B | P14195 | Leucine-rich repeat-containing protein AAC1 | 2.55e-06 | NA | 8.18e-09 |
| 3. B | B2RYF1 | Protein phosphatase 1 regulatory subunit 37 | 8.34e-08 | NA | 7.80e-11 |
| 3. B | Q66X03 | NACHT, LRR and PYD domains-containing protein 9A | 2.02e-06 | NA | 4.76e-06 |
| 3. B | Q8K3Z0 | Nucleotide-binding oligomerization domain-containing protein 2 | 1.39e-07 | NA | 5.19e-13 |
| 3. B | Q9NZR1 | Tropomodulin-2 | 2.36e-04 | NA | 7.43e-05 |
| 3. B | Q86W25 | NACHT, LRR and PYD domains-containing protein 13 | 2.20e-07 | NA | 1.60e-09 |
| 3. B | P59047 | NACHT, LRR and PYD domains-containing protein 5 | 3.57e-05 | NA | 2.54e-13 |
| 3. B | Q54G18 | Rho GTPase-activating protein gacW | 8.44e-05 | NA | 2.64e-10 |
| 3. B | Q8CIM1 | Leucine-rich repeat-containing protein 45 | 1.18e-04 | NA | 1.89e-16 |
| 3. B | Q9JKK7 | Tropomodulin-2 | 2.96e-04 | NA | 2.51e-04 |
| 3. B | Q9HC29 | Nucleotide-binding oligomerization domain-containing protein 2 | 8.62e-08 | NA | 1.52e-13 |
| 3. B | P29315 | Ribonuclease inhibitor | 6.70e-10 | NA | 2.20e-13 |
| 3. B | E1BTG2 | Leiomodin-2 | 8.75e-03 | NA | 0.004 |
| 3. B | P34342 | Ran GTPase-activating protein 2 | 2.26e-04 | NA | 4.87e-04 |
| 3. B | Q5XHY1 | Capping protein, Arp2/3 and myosin-I linker protein 3 | 3.09e-04 | NA | 1.28e-05 |
| 3. B | Q6F5E8 | Capping protein, Arp2/3 and myosin-I linker protein 2 | 5.76e-04 | NA | 8.90e-06 |
| 3. B | Q9FJ57 | Protein TORNADO 1 | 2.86e-03 | NA | 0.002 |
| 3. B | Q86W28 | NACHT, LRR and PYD domains-containing protein 8 | 3.24e-05 | NA | 8.91e-06 |
| 3. B | P46060 | Ran GTPase-activating protein 1 | 2.80e-08 | NA | 5.37e-06 |
| 3. B | Q91VI7 | Ribonuclease inhibitor | 6.45e-10 | NA | 4.19e-12 |
| 3. B | Q7RTR2 | NLR family CARD domain-containing protein 3 | 9.42e-07 | NA | 5.12e-26 |
| 3. B | Q8C6J9 | NACHT, LRR and PYD domains-containing protein 4B | 1.79e-07 | NA | 3.10e-05 |
| 3. B | F7D3V9 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 3.44e-02 | NA | 0.020 |
| 3. B | Q6Q4D0 | Protein TONSOKU | 9.74e-04 | NA | 2.24e-04 |
| 3. B | Q4R642 | Dynein regulatory complex subunit 5 | 1.27e-06 | NA | 1.53e-13 |
| 3. B | O13066 | Ran GTPase-activating protein 1 | 1.53e-07 | NA | 2.30e-06 |
| 3. B | Q8BKR5 | Protein phosphatase 1 regulatory subunit 37 | 6.31e-08 | NA | 5.05e-11 |
| 3. B | D4A615 | Tonsoku-like protein | 2.23e-04 | NA | 0.002 |
| 3. B | Q3TKR3 | NACHT, LRR and PYD domains-containing protein 4C | 4.45e-09 | NA | 0.021 |
| 3. B | P46061 | Ran GTPase-activating protein 1 | 2.84e-07 | NA | 2.31e-05 |
| 3. B | Q3V3V9 | Capping protein, Arp2/3 and myosin-I linker protein 2 | 3.41e-04 | NA | 6.37e-06 |
| 3. B | Q5JTW2 | Centrosomal protein of 78 kDa | 5.34e-05 | NA | 0.005 |
| 3. B | Q288C4 | NACHT, LRR and PYD domains-containing protein 9 | 1.55e-09 | NA | 2.92e-09 |
| 3. B | Q66X01 | NACHT, LRR and PYD domains-containing protein 9C | 1.25e-07 | NA | 1.77e-05 |
| 3. B | E9Q5R7 | NACHT, LRR and PYD domains-containing protein 12 | 8.93e-07 | NA | 4.07e-16 |
| 3. B | Q4UNE4 | Putative ankyrin repeat protein RF_0063 | 1.27e-02 | NA | 0.029 |
| 3. B | P59046 | NACHT, LRR and PYD domains-containing protein 12 | 5.25e-06 | NA | 1.43e-11 |
| 3. B | Q9NYL9 | Tropomodulin-3 | 6.48e-04 | NA | 0.003 |
| 3. B | Q9VIW3 | Ran GTPase-activating protein | 5.96e-08 | NA | 2.37e-10 |
| 3. B | Q5ZI11 | Leucine-rich repeat-containing protein 45 | 2.27e-05 | NA | 3.19e-14 |
| 3. B | Q1ZXD6 | Probable serine/threonine-protein kinase roco5 | NA | NA | 3.58e-05 |
| 3. B | Q647I9 | NACHT, LRR and PYD domains-containing protein 5 | 3.65e-07 | NA | 1.87e-10 |
| 3. B | Q8HZP9 | Ribonuclease inhibitor | 9.06e-10 | NA | 1.91e-07 |
| 3. B | Q19857 | Protein phosphatase 1 regulatory subunit 37 homolog | 9.89e-08 | NA | 2.01e-11 |
| 3. B | Q0P5G1 | Tonsoku-like protein | 1.83e-05 | NA | 4.37e-05 |
| 3. B | Q86UT6 | NLR family member X1 | 1.28e-03 | NA | 0.001 |
| 3. B | B0FPE9 | NACHT, LRR and PYD domains-containing protein 3 | 3.15e-07 | NA | 1.34e-07 |
| 3. B | Q9JLH8 | Tropomodulin-4 | 8.57e-04 | NA | 0.001 |
| 3. B | Q95VZ3 | Protein CARMIL | 1.01e-05 | NA | 4.00e-10 |
| 3. B | A2RRS8 | Centrosomal protein of 78 kDa | 1.45e-04 | NA | 0.001 |
| 3. B | Q6E804 | Nucleotide-binding oligomerization domain-containing protein 2 | 2.92e-07 | NA | 1.17e-10 |
| 3. B | Q3UP24 | NLR family CARD domain-containing protein 4 | 1.02e-03 | NA | 0.040 |
| 3. B | Q8ND23 | Capping protein, Arp2/3 and myosin-I linker protein 3 | 4.41e-04 | NA | 8.84e-06 |
| 3. B | Q8VZG8 | MDIS1-interacting receptor like kinase 2 | 5.57e-02 | NA | 0.047 |
| 3. B | Q8BHB0 | Nucleotide-binding oligomerization domain-containing protein 1 | 2.51e-07 | NA | 3.52e-12 |
| 3. B | Q53B87 | Nucleotide-binding oligomerization domain-containing protein 2 | 3.51e-07 | NA | 1.88e-13 |
| 3. B | P79621 | MHC class II transactivator | 1.11e-03 | NA | 0.020 |
| 3. B | O75864 | Protein phosphatase 1 regulatory subunit 37 | 1.76e-07 | NA | 3.95e-11 |
| 3. B | Q86W24 | NACHT, LRR and PYD domains-containing protein 14 | 1.54e-06 | NA | 7.00e-10 |
| 3. B | Q66X22 | NACHT, LRR and PYD domains-containing protein 9B | 1.95e-06 | NA | 4.95e-06 |
| 3. B | Q8BU40 | NACHT, LRR and PYD domains-containing protein 4A | 4.43e-09 | NA | 7.86e-04 |
| 3. B | O22476 | Protein BRASSINOSTEROID INSENSITIVE 1 | 1.61e-02 | NA | 0.045 |
| 3. B | Q9NX02 | NACHT, LRR and PYD domains-containing protein 2 | 5.00e-08 | NA | 5.04e-08 |
| 3. B | Q6NZL6 | Tonsoku-like protein | 6.42e-05 | NA | 0.015 |
| 3. B | D4A523 | NACHT, LRR and PYD domains-containing protein 3 | 1.43e-07 | NA | 1.00e-07 |
| 3. B | P70566 | Tropomodulin-2 | 1.61e-04 | NA | 2.13e-04 |
| 3. B | Q8R4B8 | NACHT, LRR and PYD domains-containing protein 3 | 3.69e-06 | NA | 1.07e-06 |