Summary

Q0VFZ6

Homolog: A0JLY1.
Function: Coiled-coil domain-containing protein 173.

Statistics

Total GO Annotation: 55
Unique PROST Go: 48
Unique BLAST Go: 6

Total Homologs: 39
Unique PROST Homologs: 36
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A0JLY1 (Coiled-coil domain-containing protein 173) with a FATCAT P-Value: 5.55e-16 and RMSD of 4.60 angstrom. The sequence alignment identity is 74.5%.
Structural alignment shown in left. Query protein Q0VFZ6 colored as red in alignment, homolog A0JLY1 colored as blue. Query protein Q0VFZ6 is also shown in right top, homolog A0JLY1 showed in right bottom. They are colored based on secondary structures. 

  Q0VFZ6 MDTSSEMLVRFGRRCGRAKESTEIRNSEEDQVLYLPLLPSKVDLQQVTIIPHDEWKRIQDSLDRLTREAACLRAERKAKKEMHLRSQEVVKHWTNTYAGM 100
  A0JLY1 ------MQVRFGRRSGQAKESQGMDCFEKEEIPYPPLLPSKVDLQQITIIPHAEWERIRDSLNRLTREAAVLRAERAAKKKMHVKSQELVKHWTNTYAGM 94

  Q0VFZ6 KEQKLEAKKKRDEEIEAERQILDLEEEIYKQGKRKKAIENAKQYQFYQTERVKNFHSGLLLSRVMKERDAQIEFRKSKIKSDKKWEEQLKLNIEKAFKEE 200
  A0JLY1 KEQKLKAKQKRDEEIEAERKVLDLEEEIYKEGERKKAIESARQCQFHQTERVKRFHSGLLLSRVMKERDVQIQYKKNAVKSDKKWEEQVKLNDEKAFKED 194

  Q0VFZ6 QEKAEKRHRERVALAKDHLKQIKEHEEEEERRKKYEEKDAEEIKRQNALYEIEMRKKLEKKREEMHESRRRFLEHMQDKHIIKAVEQQQQEEEDEKMRKF 300
  A0JLY1 QEKEEKRRRERVALAEDHLKQIEEHKEEEEARKKSEEKDAEEMKRQNLLYEIEMKKNLSKKQEEIDTNRKLLLDNMHNKNIIRAVEQQQQEEEDEKIRKF 294

  Q0VFZ6 IKAKKRLIQMGKEKEAETHRLMEKRRERIHNFLSELLKEKLDNEDMIIARDIAEAEAEWEKREREKDEKNKAELKTIAEYRAIVMKNKEEEERQRKIEAK 400
  A0JLY1 IKAKKRLIQMRMDKDAETHRLMEERRERINNFLSKLIKEKLDTEDLIIARDISEADAELEKREKEKHEKNQADLKAIAEYRASVMKNKEEEERQRKIEAK 394

  Q0VFZ6 EQLLAVMKADQIFWEHEKEKKCKADKEHQEVQDAHIQQMAKNKFNAKQAKQAELDYCRLTEALVAEKEKEFQDYAREVIELESETTNKYIYPLVKAVQEG 500
  A0JLY1 EQLQAVLKADKIFQELEKEKSLKVTREKLEIQDAHIQQIAINKYNAKQMKEEELDYWRLTDALTVEKEKEFEKYAREVINFESESTKKYAYPMVKAVQEG 494

  Q0VFZ6 PGGGRGPVFVDRGGLRPSYQANDVTGVQLPFYNSQGPKYN-FQKSKRRLGFTW 552
  A0JLY1 VGGGRGPPFVGRGGIRPSYQATDATGVQLPCFKSQGSKYNDFQKSKRRLGFTW 547

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0003341 cilium movement
2. P GO:0036126 sperm flagellum
2. P GO:0034613 cellular protein localization
2. P GO:0055001 muscle cell development
2. P GO:0097539 ciliary transition fiber
2. P GO:0035082 axoneme assembly
2. P GO:0007420 brain development
2. P GO:0035889 otolith tethering
2. P GO:0005874 microtubule
2. P GO:0030308 negative regulation of cell growth
2. P GO:0070286 axonemal dynein complex assembly
2. P GO:0045095 keratin filament
2. P GO:0003351 epithelial cilium movement involved in extracellular fluid movement
2. P GO:0007283 spermatogenesis
2. P GO:0005794 Golgi apparatus
2. P GO:0030057 desmosome
2. P GO:0031267 small GTPase binding
2. P GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry
2. P GO:0060271 cilium assembly
2. P GO:0097546 ciliary base
2. P GO:0030317 flagellated sperm motility
2. P GO:0031514 motile cilium
2. P GO:0060285 cilium-dependent cell motility
2. P GO:0007288 sperm axoneme assembly
2. P GO:0006915 apoptotic process
2. P GO:0003355 cilium movement involved in otolith formation
2. P GO:0005813 centrosome
2. P GO:1904526 regulation of microtubule binding
2. P GO:0007368 determination of left/right symmetry
2. P GO:0051321 meiotic cell cycle
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0070986 left/right axis specification
2. P GO:0030030 cell projection organization
2. P GO:0045179 apical cortex
2. P GO:0036064 ciliary basal body
2. P GO:0005882 intermediate filament
2. P GO:0005856 cytoskeleton
2. P GO:0008017 microtubule binding
2. P GO:0005930 axoneme
2. P GO:1902018 negative regulation of cilium assembly
2. P GO:0005929 cilium
2. P GO:0061966 establishment of left/right asymmetry
2. P GO:0044782 cilium organization
2. P GO:0045724 positive regulation of cilium assembly
2. P GO:0097729 9+2 motile cilium
2. P GO:0045880 positive regulation of smoothened signaling pathway
2. P GO:1903566 positive regulation of protein localization to cilium
2. P GO:0005635 nuclear envelope
2. P GO:0060294 cilium movement involved in cell motility
3. B GO:0021591 ventricular system development
3. B GO:1904158 axonemal central apparatus assembly
3. B GO:0002064 epithelial cell development
3. B GO:0060438 trachea development
3. B GO:1990718 axonemal central pair projection
3. B GO:1990716 axonemal central apparatus

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q0VFZ6 Coiled-coil domain-containing protein 173 0 2.18e-158 0.0
1. PB A0JLY1 Coiled-coil domain-containing protein 173 5.55e-16 5.44e-81 0.0
2. P Q9UL16 Cilia- and flagella-associated protein 45 4.83e-06 2.16e-09 NA
2. P Q96M91 Cilia- and flagella-associated protein 53 1.23e-09 3.25e-29 NA
2. P Q3V037 Uncharacterized protein C6orf163 homolog 3.56e-09 3.70e-03 NA
2. P Q7XJ96 Dynein regulatory complex subunit 4 2.54e-08 8.76e-03 NA
2. P A8I9E8 Cilia- and flagella-associated protein 45 3.18e-07 1.25e-15 NA
2. P Q4R7T8 Meiosis-specific nuclear structural protein 1 2.77e-10 2.15e-33 NA
2. P Q3UI66 Coiled-coil domain-containing protein 34 9.20e-03 2.76e-03 NA
2. P A5D7M3 Dynein regulatory complex subunit 4 1.07e-07 2.17e-03 NA
2. P D6REC4 Cilia- and flagella-associated protein 99 1.30e-03 4.73e-03 NA
2. P Q9D439 Cilia- and flagella-associated protein 53 1.27e-09 3.86e-36 NA
2. P Q2KIQ2 Meiosis-specific nuclear structural protein 1 1.73e-11 7.69e-33 NA
2. P Q3TVW5 Trichoplein keratin filament-binding protein 5.83e-11 2.18e-24 NA
2. P Q95JY7 Uncharacterized protein C6orf163 homolog 5.76e-08 9.46e-06 NA
2. P A4IJ21 Meiosis-specific nuclear structural protein 1 9.88e-10 3.28e-18 NA
2. P Q5RE49 Trichoplein keratin filament-binding protein 2.12e-10 2.96e-23 NA
2. P Q60779 Dynein regulatory complex subunit 4 4.07e-07 4.94e-03 NA
2. P Q9BT92 Trichoplein keratin filament-binding protein 4.69e-10 3.45e-21 NA
2. P A8IRJ7 Cilia- and flagella-associated protein 53 8.75e-11 1.91e-22 NA
2. P F1QNW4 Dynein regulatory complex subunit 4 3.57e-08 1.03e-03 NA
2. P Q1RM03 Trichoplein keratin filament-binding protein 1.58e-09 2.20e-20 NA
2. P Q8NEH6 Meiosis-specific nuclear structural protein 1 2.17e-11 1.10e-30 NA
2. P Q6AXQ8 Meiosis-specific nuclear structural protein 1 6.78e-11 2.36e-39 NA
2. P Q9H4K1 RIB43A-like with coiled-coils protein 2 1.18e-06 1.42e-02 NA
2. P O15697 Trypanin 8.68e-07 1.38e-06 NA
2. P Q8MT08 Dynein regulatory complex subunit 4 5.00e-08 1.29e-02 NA
2. P Q96J88 Epithelial-stromal interaction protein 1 6.61e-05 1.92e-03 NA
2. P Q2TBK0 Uncharacterized protein C6orf163 homolog 3.78e-09 2.51e-05 NA
2. P Q9NUD7 Uncharacterized protein C20orf96 1.60e-04 3.24e-02 NA
2. P Q61884 Meiosis-specific nuclear structural protein 1 1.39e-09 2.10e-32 NA
2. P O95995 Dynein regulatory complex subunit 4 2.13e-07 6.17e-04 NA
2. P Q8VDI1 Epithelial-stromal interaction protein 1 5.63e-05 4.12e-03 NA
2. P Q6PBA8 Meiosis-specific nuclear structural protein 1 6.01e-11 1.91e-18 NA
2. P A0AUT1 Trichoplein keratin filament-binding protein 6.08e-11 1.62e-28 NA
2. P A0A0R4IFG5 Cilia- and flagella-associated protein 53 6.77e-09 6.22e-40 NA
2. P Q5TEZ5 Uncharacterized protein C6orf163 8.05e-08 6.03e-04 NA
2. P Q499U4 Dynein regulatory complex subunit 4 2.15e-07 1.28e-03 NA
3. B Q4G0P3 Hydrocephalus-inducing protein homolog NA NA 0.004