Summary

Q13070

Homolog: P0CL82.
Function: G antigen 12I.

Statistics

Total GO Annotation: 2
Unique PROST Go: 0
Unique BLAST Go: 2

Total Homologs: 23
Unique PROST Homologs: 0
Unique BLAST Homologs: 3

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P0CL82 (G antigen 12I) with a FATCAT P-Value: 5.92e-10 and RMSD of 1.84 angstrom. The sequence alignment identity is 97.4%.
Structural alignment shown in left. Query protein Q13070 colored as red in alignment, homolog P0CL82 colored as blue. Query protein Q13070 is also shown in right top, homolog P0CL82 showed in right bottom. They are colored based on secondary structures. 

  Q13070 MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEVDPP 100
  P0CL82 MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPP 100

  Q13070 NPEEVKTPEEGEKQSQC 117
  P0CL82 NPEEVKTPEEGEKQSQC 117

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
3. B GO:0004222 metalloendopeptidase activity
3. B GO:0005618 cell wall

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8WWM1 X antigen family member 5 6.72e-03 1.52e-07 2.06e-07
1. PB A6NGK3 G antigen 10 9.07e-07 3.66e-42 2.37e-64
1. PB A6NDE8 G antigen 12H 3.10e-08 2.93e-61 1.34e-74
1. PB P0CL82 G antigen 12I 5.92e-10 2.60e-89 1.90e-76
1. PB Q13069 G antigen 5 3.77e-09 2.64e-100 1.03e-77
1. PB Q96GT9 X antigen family member 2 3.72e-03 3.54e-02 6.09e-18
1. PB Q4V326 G antigen 2E 6.17e-09 2.06e-57 2.86e-71
1. PB Q8WTP9 X antigen family member 3 8.83e-03 3.06e-10 1.29e-13
1. PB Q13070 G antigen 6 0 8.87e-144 3.46e-78
1. PB P0CL80 G antigen 12F 2.03e-09 2.60e-89 1.90e-76
1. PB O76087 G antigen 7 7.98e-09 2.60e-89 1.90e-76
1. PB A6NER3 G antigen 12J 4.96e-08 1.46e-62 1.82e-75
1. PB P0DSO3 G antigen 4 2.61e-08 3.35e-91 2.61e-77
1. PB Q6NT46 G antigen 2A 2.55e-09 3.54e-58 3.59e-71
1. PB P0DTW1 G antigen 1 1.14e-08 6.21e-91 2.95e-76
1. PB Q4V321 G antigen 13 9.75e-09 2.36e-100 9.73e-77
1. PB P0CL81 G antigen 12G 1.73e-08 2.60e-89 1.90e-76
1. PB Q9UEU5 G antigen 2D 1.52e-06 6.82e-64 1.80e-72
1. PB A1L429 G antigen 12B/C/D/E 1.83e-09 9.39e-71 4.63e-75
1. PB Q13066 G antigen 2B/2C 4.18e-08 6.46e-62 1.24e-71
3. B Q9L7Q2 Zinc metalloprotease ZmpB 9.98e-01 NA 0.007
3. B Q8DQN5 Zinc metalloprotease ZmpB 9.97e-01 NA 0.031
3. B O75459 P antigen family member 1 2.42e-03 NA 9.22e-16