Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q5E9A1
(Nascent polypeptide-associated complex subunit alpha) with a FATCAT P-Value: 0.0 and RMSD of 1.93 angstrom. The sequence alignment identity is 99.5%.
Structural alignment shown in left. Query protein Q13765 colored as red in alignment, homolog Q5E9A1 colored as blue.
Query protein Q13765 is also shown in right top, homolog Q5E9A1 showed in right bottom. They are colored based on secondary structures.
Q13765 MPGEATETVPATEQELPQPQAETGSGTESDSDESVPELEEQDSTQATTQQAQLAAAAEIDEEPVSKAKQSRSEKKARKAMSKLGLRQVTGVTRVTIRKSK 100 Q5E9A1 MPGEATDTVPATEQELPQPQAETGSGTESDSDESVPELEEQDSTQATTQQAQLAAAAEIDEEPVSKAKQSRSEKKARKAMSKLGLRQVTGVTRVTIRKSK 100 Q13765 NILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALK 200 Q5E9A1 NILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALK 200 Q13765 NNSNDIVNAIMELTM 215 Q5E9A1 NNSNDIVNAIMELTM 215
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005737 | cytoplasm |
| 1. PB | GO:0050821 | protein stabilization |
| 1. PB | GO:0030239 | myofibril assembly |
| 1. PB | GO:0070273 | phosphatidylinositol-4-phosphate binding |
| 1. PB | GO:0080025 | phosphatidylinositol-3,5-bisphosphate binding |
| 1. PB | GO:0017025 | TBP-class protein binding |
| 1. PB | GO:0061384 | heart trabecula morphogenesis |
| 1. PB | GO:0010664 | negative regulation of striated muscle cell apoptotic process |
| 1. PB | GO:0003713 | transcription coactivator activity |
| 1. PB | GO:1901228 | positive regulation of transcription from RNA polymerase II promoter involved in heart development |
| 1. PB | GO:0051082 | unfolded protein binding |
| 1. PB | GO:0009506 | plasmodesma |
| 1. PB | GO:0003231 | cardiac ventricle development |
| 1. PB | GO:0048633 | positive regulation of skeletal muscle tissue growth |
| 1. PB | GO:0051451 | myoblast migration |
| 1. PB | GO:0051083 | 'de novo' cotranslational protein folding |
| 1. PB | GO:0070300 | phosphatidic acid binding |
| 1. PB | GO:0022626 | cytosolic ribosome |
| 1. PB | GO:0005854 | nascent polypeptide-associated complex |
| 1. PB | GO:2000138 | positive regulation of cell proliferation involved in heart morphogenesis |
| 1. PB | GO:0042788 | polysomal ribosome |
| 1. PB | GO:0015630 | microtubule cytoskeleton |
| 1. PB | GO:0015031 | protein transport |
| 1. PB | GO:0006612 | protein targeting to membrane |
| 1. PB | GO:0047485 | protein N-terminus binding |
| 1. PB | GO:0005634 | nucleus |
| 1. PB | GO:0042060 | wound healing |
| 1. PB | GO:0043403 | skeletal muscle tissue regeneration |
| 1. PB | GO:0006620 | posttranslational protein targeting to endoplasmic reticulum membrane |
| 1. PB | GO:0060216 | definitive hemopoiesis |
| 1. PB | GO:1901227 | negative regulation of transcription from RNA polymerase II promoter involved in heart development |
| 1. PB | GO:0032266 | phosphatidylinositol-3-phosphate binding |
| 1. PB | GO:0048742 | regulation of skeletal muscle fiber development |
| 2. P | GO:0043066 | negative regulation of apoptotic process |
| 3. B | GO:0062040 | fungal biofilm matrix |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q1DHR3 | Nascent polypeptide-associated complex subunit alpha | 2.38e-08 | 1.28e-17 | 3.20e-43 |
| 1. PB | Q8JIU7 | Nascent polypeptide-associated complex subunit alpha | 0.00e+00 | 3.63e-99 | 1.11e-127 |
| 1. PB | Q94518 | Nascent polypeptide-associated complex subunit alpha | 2.00e-10 | 2.61e-54 | 4.33e-66 |
| 1. PB | A7EIZ1 | Nascent polypeptide-associated complex subunit alpha | 1.35e-07 | 3.90e-25 | 1.24e-42 |
| 1. PB | P87147 | Nascent polypeptide-associated complex subunit alpha | 8.13e-07 | 3.39e-04 | 6.24e-37 |
| 1. PB | Q4I2J8 | Nascent polypeptide-associated complex subunit alpha | 2.91e-09 | 8.64e-17 | 4.19e-41 |
| 1. PB | P0CP06 | Nascent polypeptide-associated complex subunit alpha | 1.11e-05 | 1.28e-03 | 9.97e-25 |
| 1. PB | A6SB28 | Nascent polypeptide-associated complex subunit alpha | 3.88e-08 | 4.32e-21 | 6.53e-35 |
| 1. PB | Q5R9I9 | Nascent polypeptide-associated complex subunit alpha | 0.00e+00 | 2.57e-116 | 6.88e-152 |
| 1. PB | Q45FF9 | Nascent polypeptide-associated complex subunit alpha | 3.22e-08 | 4.06e-18 | 1.73e-35 |
| 1. PB | Q6CDH0 | Nascent polypeptide-associated complex subunit alpha | 3.40e-08 | 4.72e-03 | 8.12e-15 |
| 1. PB | Q4WD81 | Nascent polypeptide-associated complex subunit alpha | 7.77e-10 | 1.51e-19 | 4.51e-42 |
| 1. PB | Q6BSN9 | Nascent polypeptide-associated complex subunit alpha | 5.17e-09 | 6.23e-03 | 7.24e-33 |
| 1. PB | Q6IP73 | Nascent polypeptide-associated complex subunit alpha | 0.00e+00 | 2.09e-96 | 1.31e-121 |
| 1. PB | A2R4V1 | Nascent polypeptide-associated complex subunit alpha | 1.93e-10 | 9.47e-21 | 1.36e-43 |
| 1. PB | Q8SWB5 | Nascent polypeptide-associated complex subunit alpha | 8.12e-08 | 1.98e-05 | 6.15e-05 |
| 1. PB | Q9NX55 | Huntingtin-interacting protein K | 3.83e-03 | 3.56e-02 | 0.031 |
| 1. PB | Q86S66 | Nascent polypeptide-associated complex subunit alpha | 6.51e-07 | 4.08e-35 | 3.18e-60 |
| 1. PB | Q9SZY1 | Nascent polypeptide-associated complex subunit alpha-like protein 4 | 1.37e-07 | 8.45e-33 | 1.48e-51 |
| 1. PB | P0CP07 | Nascent polypeptide-associated complex subunit alpha | 2.00e-05 | 1.72e-03 | 1.34e-24 |
| 1. PB | Q2U955 | Nascent polypeptide-associated complex subunit alpha | 2.69e-09 | 7.22e-19 | 3.73e-43 |
| 1. PB | Q2PFU1 | Huntingtin-interacting protein K | 1.05e-03 | 3.56e-02 | 0.031 |
| 1. PB | Q9BZK3 | Putative nascent polypeptide-associated complex subunit alpha-like protein | 4.29e-10 | 7.73e-54 | 1.12e-131 |
| 1. PB | A5DGN9 | Nascent polypeptide-associated complex subunit alpha | 2.45e-08 | 2.90e-03 | 3.17e-29 |
| 1. PB | Q68F90 | Nascent polypeptide-associated complex subunit alpha | 0.00e+00 | 9.30e-98 | 2.55e-146 |
| 1. PB | Q5AYK0 | Nascent polypeptide-associated complex subunit alpha | 1.11e-08 | 3.37e-18 | 6.43e-44 |
| 1. PB | A3GHD3 | Nascent polypeptide-associated complex subunit alpha | 1.48e-07 | 3.56e-03 | 7.48e-29 |
| 1. PB | Q9CR41 | Huntingtin-interacting protein K | 1.22e-02 | 2.58e-03 | 0.027 |
| 1. PB | Q6ICZ8 | Nascent polypeptide-associated complex subunit alpha-like protein 3 | 1.10e-08 | 1.53e-29 | 1.41e-49 |
| 1. PB | Q0UKB5 | Nascent polypeptide-associated complex subunit alpha | 1.80e-08 | 1.82e-17 | 1.03e-28 |
| 1. PB | Q2H4Z2 | Nascent polypeptide-associated complex subunit alpha | 8.25e-09 | 1.80e-23 | 1.21e-41 |
| 1. PB | A4RC89 | Nascent polypeptide-associated complex subunit alpha | 3.41e-08 | 1.76e-21 | 3.03e-40 |
| 1. PB | Q94JX9 | Nascent polypeptide-associated complex subunit alpha-like protein 2 | 1.39e-07 | 6.73e-44 | 1.68e-53 |
| 1. PB | Q7SI17 | Nascent polypeptide-associated complex subunit alpha | 3.09e-10 | 6.36e-23 | 4.48e-42 |
| 1. PB | Q4P341 | Nascent polypeptide-associated complex subunit alpha | 1.43e-07 | 6.52e-21 | 2.93e-31 |
| 1. PB | A5DXK7 | Nascent polypeptide-associated complex subunit alpha | 1.65e-08 | 1.18e-02 | 7.84e-30 |
| 1. PB | Q9LHG9 | Nascent polypeptide-associated complex subunit alpha-like protein 1 | 5.05e-09 | 1.11e-31 | 3.16e-53 |
| 1. PB | Q5E9A1 | Nascent polypeptide-associated complex subunit alpha | 0.00e+00 | 1.30e-119 | 1.23e-152 |
| 1. PB | Q60817 | Nascent polypeptide-associated complex subunit alpha | 0.00e+00 | 1.49e-122 | 1.09e-151 |
| 1. PB | A1CMF8 | Nascent polypeptide-associated complex subunit alpha | 3.64e-08 | 1.47e-20 | 8.17e-42 |
| 1. PB | A6R641 | Nascent polypeptide-associated complex subunit alpha | 3.98e-08 | 1.67e-20 | 2.49e-44 |
| 1. PB | Q13765 | Nascent polypeptide-associated complex subunit alpha | 0 | 5.79e-129 | 3.22e-153 |
| 1. PB | Q6QN10 | Nascent polypeptide-associated complex subunit alpha | 3.86e-10 | 1.96e-103 | 1.08e-150 |
| 1. PB | A1DLM0 | Nascent polypeptide-associated complex subunit alpha | 8.91e-10 | 1.51e-19 | 4.51e-42 |
| 1. PB | Q8LGC6 | Nascent polypeptide-associated complex subunit alpha-like protein 5 | 5.18e-07 | 1.03e-29 | 3.71e-49 |
| 1. PB | Q9H009 | Nascent polypeptide-associated complex subunit alpha-2 | 2.08e-13 | 5.57e-68 | 9.31e-129 |
| 1. PB | Q61UX1 | Nascent polypeptide-associated complex subunit alpha | 1.51e-07 | 5.72e-32 | 2.06e-61 |
| 1. PB | P0C2C7 | Nascent polypeptide-associated complex subunit alpha | 2.76e-09 | 5.15e-22 | 8.31e-43 |
| 1. PB | Q8AWF2 | Nascent polypeptide-associated complex subunit alpha | 8.18e-14 | 1.65e-94 | 1.01e-126 |
| 1. PB | Q5ANP2 | Nascent polypeptide-associated complex subunit alpha | 1.46e-07 | 4.63e-03 | 2.35e-27 |
| 1. PB | Q9M612 | Nascent polypeptide-associated complex subunit alpha-like protein | 6.09e-08 | 3.87e-31 | 2.78e-59 |
| 2. P | Q6M0I0 | Nascent polypeptide-associated complex protein | 7.15e-06 | 4.55e-02 | NA |
| 2. P | A6VIT0 | Nascent polypeptide-associated complex protein | 7.31e-06 | 4.31e-02 | NA |
| 3. B | O15069 | NAC-alpha domain-containing protein 1 | 7.66e-02 | NA | 3.56e-74 |
| 3. B | Q5SWP3 | NAC-alpha domain-containing protein 1 | 4.37e-02 | NA | 1.43e-65 |
| 3. B | E9PAV3 | Nascent polypeptide-associated complex subunit alpha, muscle-specific form | 1.59e-01 | NA | 6.29e-111 |
| 3. B | A7TG43 | Nascent polypeptide-associated complex subunit alpha | 3.16e-07 | NA | 3.55e-32 |
| 3. B | Q6CWG6 | Nascent polypeptide-associated complex subunit alpha | 5.55e-08 | NA | 2.32e-29 |
| 3. B | Q9HI94 | Nascent polypeptide-associated complex protein | 1.34e-03 | NA | 0.041 |
| 3. B | P38879 | Nascent polypeptide-associated complex subunit alpha | 1.57e-06 | NA | 7.09e-23 |
| 3. B | Q6FJD5 | Nascent polypeptide-associated complex subunit alpha | 2.59e-08 | NA | 1.07e-28 |
| 3. B | O26279 | Nascent polypeptide-associated complex protein | 3.81e-08 | NA | 0.007 |
| 3. B | P70670 | Nascent polypeptide-associated complex subunit alpha, muscle-specific form | 1.31e-01 | NA | 2.95e-110 |
| 3. B | Q756T5 | Nascent polypeptide-associated complex subunit alpha | 6.42e-08 | NA | 5.92e-30 |
| 3. B | Q97CI3 | Nascent polypeptide-associated complex protein | 1.29e-03 | NA | 0.009 |
| 3. B | A6ZT99 | Nascent polypeptide-associated complex subunit alpha | 4.27e-08 | NA | 7.09e-23 |
| 3. B | Q54U07 | Nascent polypeptide-associated complex subunit alpha | 9.76e-10 | NA | 1.54e-26 |
| 3. B | P0C0K9 | Nascent polypeptide-associated complex protein | 1.12e-07 | NA | 0.002 |