Results | PROST

Summary

Q13948

Homolog: Q5R8V1.
Function: Protein CASP.

Statistics

Total GO Annotation: 305
Unique PROST Go: 204
Unique BLAST Go: 83

Total Homologs: 181
Unique PROST Homologs: 158
Unique BLAST Homologs: 16

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q5R8V1 (Protein CASP) with a FATCAT P-Value: 0.0 and RMSD of 3.63 angstrom. The sequence alignment identity is 99.6%.
Structural alignment shown in left. Query protein Q13948 colored as red in alignment, homolog Q5R8V1 colored as blue. Query protein Q13948 is also shown in right top, homolog Q5R8V1 showed in right bottom. They are colored based on secondary structures.

  Q13948 MAANVGSMFQYWKRFDLQQLQRELDATATVLANRQDESEQSRKRLIEQSREFKKNTPEDLRKQVAPLLKSFQGEIDALSKRSKEAEAAFLNVYKRLIDVP 100
  Q5R8V1 MAANVGSMFQYWKRFDLQQLQRELDATATVLANRQDESEQSRKRLIEQSREFKKNTPEDLRKQVAPLLKSFQGEIDALSKRSKEAEAAFLNVYKRLIDVP 100

  Q13948 DPVPALDLGQQLQLKVQRLHDIETENQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQETQMSTTSK 200
  Q5R8V1 DPVPALDLGQQLQLKVQRLHDIETENQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQETQMSTTSK 200

  Q13948 LEEAEHKVQSLQTALEKTRTELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLSSANHSLQLASQIQKAPDVEQAIEVLTRSSLE 300
  Q5R8V1 LEEAEHKVQSLQTALEKTRTELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLSSANHSLQLASQIQKAPDVEQAIEVLTRSSLE 300

  Q13948 VELAAKEREIAQLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLKQLEEKLKGQADYEEVKKELNILKSMEFAPSEGAGTQDAAKPLEVLLLEKN 400
  Q5R8V1 VELAAKEREIAQLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLKQLEEKLKGQADYEEVKKELNILKSMEFAPSEGAGTQDAAKPLEVLLLEKN 400

  Q13948 RSLQSENAALRISNSDLSGRCAELQVRITEAVATATEQRELIARLEQDLSIIQSIQRPDAEGAAEHRLEKIPEPIKEATALFYGPAAPASGALPEGQVDS 500
  Q5R8V1 RSLQSENAALRISNSDLSGRCAELQVRVTEAVATATEQRELIARLEQDLSIIQSIQRPDAEGAAEHRLEKIPEPIKEATALFYGPTAPASGALPEGQVDS 500

  Q13948 LLSIISSQRERFRARNQELEAENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPW 600
  Q5R8V1 LLSIISSQRERFRARNQELEAENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSMSPW 600

  Q13948 DKATLSMGRLVLSNKMARTIGFFYTLFLHCLVFLVLYKLAWSESMERDCATFCAKKFADHLHKFHENDNGAAAGDLWQ 678
  Q5R8V1 DKATLSMGRLVLSNKMARTIGFFYTLFLHCLVFLVLYKLAWSESMERDCATFCAKKFADHLHKFHENDNGAAAGDLWQ 678

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0008017	microtubule binding
1. PB	GO:0000139	Golgi membrane
1. PB	GO:0030173	integral component of Golgi membrane
1. PB	GO:0000301	retrograde transport, vesicle recycling within Golgi
1. PB	GO:0005813	centrosome
1. PB	GO:0048193	Golgi vesicle transport
1. PB	GO:0000776	kinetochore
1. PB	GO:0000922	spindle pole
1. PB	GO:0034454	microtubule anchoring at centrosome
1. PB	GO:0006891	intra-Golgi vesicle-mediated transport
1. PB	GO:0005874	microtubule
1. PB	GO:0031122	cytoplasmic microtubule organization
1. PB	GO:0060287	epithelial cilium movement involved in determination of left/right asymmetry
1. PB	GO:0072686	mitotic spindle
1. PB	GO:0005635	nuclear envelope
1. PB	GO:0005814	centriole
1. PB	GO:0036064	ciliary basal body
1. PB	GO:0048211	Golgi vesicle docking
2. P	GO:0097539	ciliary transition fiber
2. P	GO:0140480	mitotic spindle pole body insertion into the nuclear envelope
2. P	GO:2000769	regulation of establishment or maintenance of cell polarity regulating cell shape
2. P	GO:0034993	meiotic nuclear membrane microtubule tethering complex
2. P	GO:0005768	endosome
2. P	GO:0070530	K63-linked polyubiquitin modification-dependent protein binding
2. P	GO:0060050	positive regulation of protein glycosylation
2. P	GO:0007094	mitotic spindle assembly checkpoint signaling
2. P	GO:0030705	cytoskeleton-dependent intracellular transport
2. P	GO:0045141	meiotic telomere clustering
2. P	GO:0005881	cytoplasmic microtubule
2. P	GO:0030951	establishment or maintenance of microtubule cytoskeleton polarity
2. P	GO:0080115	myosin XI tail binding
2. P	GO:0090161	Golgi ribbon formation
2. P	GO:0007060	male meiosis chromosome segregation
2. P	GO:0071539	protein localization to centrosome
2. P	GO:0045503	dynein light chain binding
2. P	GO:0000406	double-strand/single-strand DNA junction binding
2. P	GO:0051026	chiasma assembly
2. P	GO:0047496	vesicle transport along microtubule
2. P	GO:0005796	Golgi lumen
2. P	GO:1903251	multi-ciliated epithelial cell differentiation
2. P	GO:1990683	DNA double-strand break attachment to nuclear envelope
2. P	GO:0044615	nuclear pore nuclear basket
2. P	GO:0048874	host-mediated regulation of intestinal microbiota composition
2. P	GO:2000318	positive regulation of T-helper 17 type immune response
2. P	GO:0106300	protein-DNA covalent cross-linking repair
2. P	GO:0070336	flap-structured DNA binding
2. P	GO:0034451	centriolar satellite
2. P	GO:0003690	double-stranded DNA binding
2. P	GO:0098882	structural constituent of presynaptic active zone
2. P	GO:1902254	negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator
2. P	GO:1905198	manchette assembly
2. P	GO:0071957	old mitotic spindle pole body
2. P	GO:0032091	negative regulation of protein binding
2. P	GO:0023035	CD40 signaling pathway
2. P	GO:0031021	interphase microtubule organizing center
2. P	GO:0051647	nucleus localization
2. P	GO:1902440	protein localization to mitotic spindle pole body
2. P	GO:0009903	chloroplast avoidance movement
2. P	GO:0051321	meiotic cell cycle
2. P	GO:0044877	protein-containing complex binding
2. P	GO:0000138	Golgi trans cisterna
2. P	GO:0071907	determination of digestive tract left/right asymmetry
2. P	GO:0035092	sperm DNA condensation
2. P	GO:0007030	Golgi organization
2. P	GO:0019094	pole plasm mRNA localization
2. P	GO:0007032	endosome organization
2. P	GO:0007020	microtubule nucleation
2. P	GO:0051645	Golgi localization
2. P	GO:0005929	cilium
2. P	GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
2. P	GO:0048790	maintenance of presynaptic active zone structure
2. P	GO:0032663	regulation of interleukin-2 production
2. P	GO:0098535	de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P	GO:0001673	male germ cell nucleus
2. P	GO:0090166	Golgi disassembly
2. P	GO:0097431	mitotic spindle pole
2. P	GO:0022027	interkinetic nuclear migration
2. P	GO:0050871	positive regulation of B cell activation
2. P	GO:0000711	meiotic DNA repair synthesis
2. P	GO:0032494	response to peptidoglycan
2. P	GO:0051301	cell division
2. P	GO:0007420	brain development
2. P	GO:0002756	MyD88-independent toll-like receptor signaling pathway
2. P	GO:0051642	centrosome localization
2. P	GO:0008356	asymmetric cell division
2. P	GO:0044774	mitotic DNA integrity checkpoint signaling
2. P	GO:0051315	attachment of mitotic spindle microtubules to kinetochore
2. P	GO:0045505	dynein intermediate chain binding
2. P	GO:0010507	negative regulation of autophagy
2. P	GO:0000802	transverse filament
2. P	GO:0003341	cilium movement
2. P	GO:1990612	Sad1-Kms1 LINC complex
2. P	GO:0007098	centrosome cycle
2. P	GO:0071910	determination of liver left/right asymmetry
2. P	GO:0032880	regulation of protein localization
2. P	GO:1990810	microtubule anchoring at mitotic spindle pole body
2. P	GO:0051959	dynein light intermediate chain binding
2. P	GO:0070498	interleukin-1-mediated signaling pathway
2. P	GO:1901925	negative regulation of protein import into nucleus during spindle assembly checkpoint
2. P	GO:0051878	lateral element assembly
2. P	GO:0034134	toll-like receptor 2 signaling pathway
2. P	GO:0106166	spindle pole body-nuclear membrane anchor activity
2. P	GO:0005802	trans-Golgi network
2. P	GO:0005823	central plaque of spindle pole body
2. P	GO:0007129	homologous chromosome pairing at meiosis
2. P	GO:1904931	MCM complex binding
2. P	GO:0060285	cilium-dependent cell motility
2. P	GO:0055107	Golgi to secretory granule transport
2. P	GO:0042130	negative regulation of T cell proliferation
2. P	GO:0120229	protein localization to motile cilium
2. P	GO:0005886	plasma membrane
2. P	GO:0043015	gamma-tubulin binding
2. P	GO:0030030	cell projection organization
2. P	GO:0036159	inner dynein arm assembly
2. P	GO:0090306	meiotic spindle assembly
2. P	GO:0006913	nucleocytoplasmic transport
2. P	GO:0043001	Golgi to plasma membrane protein transport
2. P	GO:0034162	toll-like receptor 9 signaling pathway
2. P	GO:0051649	establishment of localization in cell
2. P	GO:0005816	spindle pole body
2. P	GO:0051298	centrosome duplication
2. P	GO:0007130	synaptonemal complex assembly
2. P	GO:0061676	importin-alpha family protein binding
2. P	GO:0008333	endosome to lysosome transport
2. P	GO:0070732	spindle envelope
2. P	GO:0090235	regulation of metaphase plate congression
2. P	GO:0071222	cellular response to lipopolysaccharide
2. P	GO:0042734	presynaptic membrane
2. P	GO:0000801	central element
2. P	GO:0051225	spindle assembly
2. P	GO:2000352	negative regulation of endothelial cell apoptotic process
2. P	GO:0071988	protein localization to spindle pole body
2. P	GO:0031985	Golgi cisterna
2. P	GO:1903087	mitotic spindle pole body duplication
2. P	GO:0007317	regulation of pole plasm oskar mRNA localization
2. P	GO:0009637	response to blue light
2. P	GO:0003382	epithelial cell morphogenesis
2. P	GO:0110120	gamma-tubulin complex localization to nuclear side of mitotic spindle pole body
2. P	GO:0005876	spindle microtubule
2. P	GO:0007100	mitotic centrosome separation
2. P	GO:0002446	neutrophil mediated immunity
2. P	GO:1905719	protein localization to perinuclear region of cytoplasm
2. P	GO:0045022	early endosome to late endosome transport
2. P	GO:1990450	linear polyubiquitin binding
2. P	GO:0097150	neuronal stem cell population maintenance
2. P	GO:0070286	axonemal dynein complex assembly
2. P	GO:0009904	chloroplast accumulation movement
2. P	GO:0045162	clustering of voltage-gated sodium channels
2. P	GO:0007249	I-kappaB kinase/NF-kappaB signaling
2. P	GO:0007131	reciprocal meiotic recombination
2. P	GO:1990811	MWP complex
2. P	GO:0030134	COPII-coated ER to Golgi transport vesicle
2. P	GO:0000280	nuclear division
2. P	GO:0043515	kinetochore binding
2. P	GO:0099518	vesicle cytoskeletal trafficking
2. P	GO:0043621	protein self-association
2. P	GO:0006897	endocytosis
2. P	GO:0008385	IkappaB kinase complex
2. P	GO:0010792	DNA double-strand break processing involved in repair via single-strand annealing
2. P	GO:0048278	vesicle docking
2. P	GO:0070695	FHF complex
2. P	GO:0007099	centriole replication
2. P	GO:0031593	polyubiquitin modification-dependent protein binding
2. P	GO:0000242	pericentriolar material
2. P	GO:0120317	sperm mitochondrial sheath assembly
2. P	GO:0005930	axoneme
2. P	GO:0090268	activation of mitotic cell cycle spindle assembly checkpoint
2. P	GO:0099606	microtubule plus-end directed mitotic chromosome migration
2. P	GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling
2. P	GO:0061966	establishment of left/right asymmetry
2. P	GO:0035469	determination of pancreatic left/right asymmetry
2. P	GO:0051660	establishment of centrosome localization
2. P	GO:0090307	mitotic spindle assembly
2. P	GO:1901214	regulation of neuron death
2. P	GO:0017075	syntaxin-1 binding
2. P	GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling
2. P	GO:0044732	mitotic spindle pole body
2. P	GO:1901990	regulation of mitotic cell cycle phase transition
2. P	GO:0030182	neuron differentiation
2. P	GO:0042803	protein homodimerization activity
2. P	GO:0051303	establishment of chromosome localization
2. P	GO:0007040	lysosome organization
2. P	GO:0051289	protein homotetramerization
2. P	GO:0000775	chromosome, centromeric region
2. P	GO:0034138	toll-like receptor 3 signaling pathway
2. P	GO:0098536	deuterosome
2. P	GO:1903445	protein transport from ciliary membrane to plasma membrane
2. P	GO:2000574	obsolete regulation of microtubule motor activity
2. P	GO:0034452	dynactin binding
2. P	GO:0005822	inner plaque of spindle pole body
2. P	GO:0048538	thymus development
2. P	GO:0005794	Golgi apparatus
2. P	GO:0045450	bicoid mRNA localization
2. P	GO:0061496	half bridge of mitotic spindle pole body
2. P	GO:0000794	condensed nuclear chromosome
2. P	GO:0005871	kinesin complex
2. P	GO:0031267	small GTPase binding
2. P	GO:0060271	cilium assembly
2. P	GO:0099635	voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels
2. P	GO:0007294	germarium-derived oocyte fate determination
2. P	GO:0031175	neuron projection development
2. P	GO:0030663	COPI-coated vesicle membrane
2. P	GO:1902426	deactivation of mitotic spindle assembly checkpoint
2. P	GO:0003356	regulation of cilium beat frequency
2. P	GO:0007368	determination of left/right symmetry
2. P	GO:0032495	response to muramyl dipeptide
2. P	GO:0005637	nuclear inner membrane
2. P	GO:0005829	cytosol
2. P	GO:0000795	synaptonemal complex
2. P	GO:0000137	Golgi cis cisterna
2. P	GO:0032449	CBM complex
2. P	GO:0005801	cis-Golgi network
2. P	GO:0005797	Golgi medial cisterna
2. P	GO:0051220	cytoplasmic sequestering of protein
2. P	GO:0042770	signal transduction in response to DNA damage
2. P	GO:0043032	positive regulation of macrophage activation
2. P	GO:0050768	negative regulation of neurogenesis
2. P	GO:0000077	DNA damage checkpoint signaling
2. P	GO:0042802	identical protein binding
2. P	GO:0048788	cytoskeleton of presynaptic active zone
2. P	GO:0071439	clathrin complex
2. P	GO:0070016	armadillo repeat domain binding
3. B	GO:1990535	neuron projection maintenance
3. B	GO:0071711	basement membrane organization
3. B	GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific
3. B	GO:0050905	neuromuscular process
3. B	GO:0007411	axon guidance
3. B	GO:0051010	microtubule plus-end binding
3. B	GO:0005868	cytoplasmic dynein complex
3. B	GO:0051081	nuclear membrane disassembly
3. B	GO:0007414	axonal defasciculation
3. B	GO:0050775	positive regulation of dendrite morphogenesis
3. B	GO:0000122	negative regulation of transcription by RNA polymerase II
3. B	GO:0021517	ventral spinal cord development
3. B	GO:0009888	tissue development
3. B	GO:0005608	laminin-3 complex
3. B	GO:0061003	positive regulation of dendritic spine morphogenesis
3. B	GO:0006937	regulation of muscle contraction
3. B	GO:0005201	extracellular matrix structural constituent
3. B	GO:0002011	morphogenesis of an epithelial sheet
3. B	GO:0048156	tau protein binding
3. B	GO:0005819	spindle
3. B	GO:0005606	laminin-1 complex
3. B	GO:0007614	short-term memory
3. B	GO:0090316	positive regulation of intracellular protein transport
3. B	GO:0000132	establishment of mitotic spindle orientation
3. B	GO:0040017	positive regulation of locomotion
3. B	GO:0030424	axon
3. B	GO:0060026	convergent extension
3. B	GO:0090063	positive regulation of microtubule nucleation
3. B	GO:0045171	intercellular bridge
3. B	GO:0032402	melanosome transport
3. B	GO:0048514	blood vessel morphogenesis
3. B	GO:0045995	regulation of embryonic development
3. B	GO:0051788	response to misfolded protein
3. B	GO:0043256	laminin complex
3. B	GO:0120103	centriolar subdistal appendage
3. B	GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding
3. B	GO:0043208	glycosphingolipid binding
3. B	GO:0043565	sequence-specific DNA binding
3. B	GO:0060441	epithelial tube branching involved in lung morphogenesis
3. B	GO:0061744	motor behavior
3. B	GO:2000463	positive regulation of excitatory postsynaptic potential
3. B	GO:0099558	maintenance of synapse structure
3. B	GO:0042147	retrograde transport, endosome to Golgi
3. B	GO:0007097	nuclear migration
3. B	GO:0009887	animal organ morphogenesis
3. B	GO:0030286	dynein complex
3. B	GO:0031116	positive regulation of microtubule polymerization
3. B	GO:0003682	chromatin binding
3. B	GO:0070050	neuron cellular homeostasis
3. B	GO:0060445	branching involved in salivary gland morphogenesis
3. B	GO:0006357	regulation of transcription by RNA polymerase II
3. B	GO:0043005	neuron projection
3. B	GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
3. B	GO:0060027	convergent extension involved in gastrulation
3. B	GO:1990837	sequence-specific double-stranded DNA binding
3. B	GO:0019901	protein kinase binding
3. B	GO:0005604	basement membrane
3. B	GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
3. B	GO:0001822	kidney development
3. B	GO:0030324	lung development
3. B	GO:0000003	reproduction
3. B	GO:0043025	neuronal cell body
3. B	GO:0042491	inner ear auditory receptor cell differentiation
3. B	GO:0031252	cell leading edge
3. B	GO:0005875	microtubule associated complex
3. B	GO:0071310	cellular response to organic substance
3. B	GO:0051965	positive regulation of synapse assembly
3. B	GO:0061304	retinal blood vessel morphogenesis
3. B	GO:0050890	cognition
3. B	GO:0010457	centriole-centriole cohesion
3. B	GO:0061371	determination of heart left/right asymmetry
3. B	GO:0015630	microtubule cytoskeleton
3. B	GO:0035371	microtubule plus-end
3. B	GO:0045198	establishment of epithelial cell apical/basal polarity
3. B	GO:0007528	neuromuscular junction development
3. B	GO:1905515	non-motile cilium assembly
3. B	GO:0060236	regulation of mitotic spindle organization
3. B	GO:0015631	tubulin binding
3. B	GO:0099738	cell cortex region
3. B	GO:0005938	cell cortex
3. B	GO:0010950	positive regulation of endopeptidase activity
3. B	GO:0030674	protein-macromolecule adaptor activity
3. B	GO:1904398	positive regulation of neuromuscular junction development

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q5R8V1	Protein CASP	0.00e+00	3.18e-145	0.0
1. PB	Q9LS42	Protein CASP	1.17e-11	3.63e-47	3.55e-96
1. PB	Q8IA98	Protein CASP	3.13e-12	2.47e-61	9.56e-69
1. PB	Q13948	Protein CASP	0	2.49e-153	0.0
1. PB	P70403	Protein CASP	0.00e+00	2.52e-109	0.0
1. PB	O59795	Protein CASP	2.78e-08	2.54e-41	3.86e-45
1. PB	P34237	Protein CASP	2.31e-09	1.31e-41	2.45e-53
2. P	Q3UPP8	Centrosomal protein of 63 kDa	4.65e-10	2.66e-02	NA
2. P	Q80U23	Syntaphilin	4.64e-02	4.32e-04	NA
2. P	F7DP49	Deuterosome assembly protein 1	8.75e-08	1.23e-02	NA
2. P	Q5T655	Cilia- and flagella-associated protein 58	4.16e-07	1.21e-03	NA
2. P	P0DMS1	Protein NETWORKED 2A	7.91e-04	3.41e-03	NA
2. P	Q62209	Synaptonemal complex protein 1	4.43e-09	2.26e-04	NA
2. P	O76878	RILP-like protein homolog	1.12e-04	1.84e-05	NA
2. P	Q9FF41	Protein PLASTID MOVEMENT IMPAIRED 15	1.22e-08	1.24e-02	NA
2. P	D3YZP9	Coiled-coil domain-containing protein 6	2.00e-08	1.21e-02	NA
2. P	Q8CHW5	BICD family-like cargo adapter 2	1.54e-09	4.08e-03	NA
2. P	Q9M8T5	WEB family protein At3g02930, chloroplastic	2.20e-08	1.45e-02	NA
2. P	P75395	Uncharacterized protein MG269 homolog	1.08e-06	2.07e-04	NA
2. P	A9QT41	NF-kappa-B essential modulator	2.97e-07	2.21e-03	NA
2. P	Q4KLY0	Centrosomal protein of 63 kDa	2.50e-10	1.01e-04	NA
2. P	B3NL60	Protein hook	6.69e-06	1.91e-02	NA
2. P	Q6FS63	Spindle assembly checkpoint component MAD1	1.33e-02	2.22e-02	NA
2. P	Q4R703	Centrosomal protein of 63 kDa	4.78e-10	2.18e-06	NA
2. P	Q9JJC6	RILP-like protein 1	9.21e-06	1.51e-06	NA
2. P	Q5M9N0	Coiled-coil domain-containing protein 158	7.90e-08	4.75e-04	NA
2. P	D3Z8K2	Coiled-coil domain-containing protein 39	8.84e-09	1.10e-02	NA
2. P	Q99JG7	TNFAIP3-interacting protein 2	4.14e-07	1.88e-03	NA
2. P	A0PJP4	RILP-like protein 1	1.22e-06	7.16e-08	NA
2. P	Q6DIX6	BICD family-like cargo adapter 2	6.19e-10	2.46e-06	NA
2. P	Q96KP6	TNFAIP3-interacting protein 3	6.05e-08	3.97e-04	NA
2. P	Q15431	Synaptonemal complex protein 1	2.55e-05	5.28e-04	NA
2. P	F1R4Y7	Centrosomal protein of 83 kDa	2.59e-10	1.08e-04	NA
2. P	Q66HR5	Calcium-binding and coiled-coil domain-containing protein 1	5.98e-07	2.02e-03	NA
2. P	Q6C452	Spindle assembly checkpoint component MAD1	2.03e-08	2.56e-02	NA
2. P	Q7PWT9	Protein hook	5.14e-06	4.10e-04	NA
2. P	Q6FY25	Spindle pole body component 110	4.68e-07	2.18e-05	NA
2. P	A0JMK8	BICD family-like cargo adapter 2	2.10e-10	1.07e-04	NA
2. P	Q874L7	Spindle assembly checkpoint component MAD1	1.47e-08	2.56e-02	NA
2. P	Q9D5R3	Centrosomal protein of 83 kDa	4.49e-11	1.36e-04	NA
2. P	Q92805	Golgin subfamily A member 1	7.08e-07	3.79e-12	NA
2. P	Q6BSY1	Spindle assembly checkpoint component MAD1	1.61e-02	3.42e-02	NA
2. P	Q8CDI6	Coiled-coil domain-containing protein 158	3.17e-08	3.27e-02	NA
2. P	Q75AF5	Golgin IMH1	7.17e-09	5.01e-07	NA
2. P	Q5U3Z6	Deuterosome assembly protein 1	2.72e-07	2.20e-02	NA
2. P	Q9UTR7	Meiotic coiled-coil protein 3	7.07e-06	2.20e-02	NA
2. P	Q754Z1	Spindle assembly checkpoint component MAD1	2.28e-09	1.72e-02	NA
2. P	Q80YF0	Mitotic spindle assembly checkpoint protein MAD1	3.66e-10	2.61e-05	NA
2. P	Q7ZVT3	Spindle assembly abnormal protein 6 homolog	2.70e-06	5.43e-03	NA
2. P	Q8BUK6	Protein Hook homolog 3	1.05e-04	2.17e-03	NA
2. P	Q32L59	Transmembrane and coiled-coil domain-containing protein 5B	1.76e-07	7.45e-04	NA
2. P	A0JNT9	BICD family-like cargo adapter 1	9.33e-09	9.17e-05	NA
2. P	Q9M9L3	Nuclear envelope-associated protein 1	1.06e-07	6.30e-06	NA
2. P	Q9EPY0	Caspase recruitment domain-containing protein 9	5.52e-07	3.00e-02	NA
2. P	Q5EBL4	RILP-like protein 1	6.49e-07	3.45e-09	NA
2. P	Q6PGZ0	Centrosomal protein of 63 kDa	1.44e-09	5.01e-07	NA
2. P	A8HUA1	Cilia- and flagella-associated protein 58	1.54e-06	1.22e-05	NA
2. P	O45717	Protein nud-2	1.26e-06	1.96e-03	NA
2. P	Q6NRV0	E3 ubiquitin-protein ligase TRAIP	9.11e-04	1.97e-02	NA
2. P	Q9U9I5	Protein swallow	1.05e-01	1.87e-02	NA
2. P	C5DY19	Spindle pole body component 110	2.77e-07	6.91e-06	NA
2. P	Q95JK1	Deuterosome assembly protein 1	1.97e-06	4.51e-04	NA
2. P	Q9ZRT1	Protein gamma response 1	1.62e-05	2.68e-03	NA
2. P	Q6P3P1	Tax1-binding protein 1 homolog	6.00e-08	3.31e-03	NA
2. P	Q0VCP9	Coiled-coil domain-containing protein 149	2.92e-05	2.51e-02	NA
2. P	Q9Y6D9	Mitotic spindle assembly checkpoint protein MAD1	1.81e-09	5.86e-04	NA
2. P	Q6PHN1	Coiled-coil domain-containing protein 57	3.43e-05	4.69e-02	NA
2. P	C5DJH6	Spindle pole body component 110	1.64e-05	2.47e-05	NA
2. P	Q0KK56	Protein FAM184B	2.50e-07	2.77e-04	NA
2. P	Q6CMM2	Spindle assembly checkpoint component MAD1	2.36e-07	2.68e-02	NA
2. P	P87245	Karyogamy meiotic segregation protein 1	5.24e-05	2.03e-05	NA
2. P	Q0V9R4	Coiled-coil domain-containing protein 39	3.45e-07	3.69e-02	NA
2. P	Q80X59	Transmembrane and coiled-coil domain-containing protein 5B	7.02e-07	7.66e-03	NA
2. P	A6ZYV5	Spindle pole body component 110	2.55e-07	2.12e-03	NA
2. P	A7THU9	Spindle pole body component 110	2.67e-08	1.79e-03	NA
2. P	Q8L7E5	WPP domain-interacting tail-anchored protein 1	1.48e-08	6.55e-07	NA
2. P	Q86VS8	Protein Hook homolog 3	1.21e-08	1.16e-02	NA
2. P	Q756L3	Spindle pole body component 110	1.62e-06	7.61e-05	NA
2. P	Q3ZU82	Golgin subfamily A member 5	3.64e-07	2.01e-08	NA
2. P	A8MYB1	Transmembrane and coiled-coil domain-containing protein 5B	1.03e-07	2.74e-04	NA
2. P	Q28BZ7	Centrosomal protein cep57l1	3.12e-05	1.82e-02	NA
2. P	A1A5D9	BICD family-like cargo adapter 2	2.28e-08	6.91e-06	NA
2. P	Q96MT8	Centrosomal protein of 63 kDa	9.27e-10	8.36e-04	NA
2. P	Q9UTJ3	Meiotic expression up-regulated protein 1/2	2.74e-08	9.97e-04	NA
2. P	B3LFU6	Spindle pole body component 110	4.25e-08	3.55e-03	NA
2. P	C5E2E7	Monopolar spindle protein 2	6.88e-05	3.90e-02	NA
2. P	Q9LXR8	Peroxisomal and mitochondrial division factor 1	3.65e-08	2.99e-03	NA
2. P	P0CF95	BICD family-like cargo adapter 1	NA	1.26e-03	NA
2. P	Q08379	Golgin subfamily A member 2	6.56e-07	5.54e-03	NA
2. P	O43087	Karyogamy meiotic segregation protein 2	4.50e-05	1.75e-02	NA
2. P	Q7SXE4	Golgin subfamily A member 5	2.41e-06	7.36e-03	NA
2. P	Q5PQJ9	Coiled-coil domain-containing protein 175	4.57e-08	2.04e-02	NA
2. P	P34562	GRIP and coiled-coil domain-containing protein 2	3.85e-09	9.32e-10	NA
2. P	Q4PT37	Nuclear envelope-associated protein 3	7.98e-07	3.24e-08	NA
2. P	Q9P6R4	Meiotically up-regulated gene 172 protein	3.48e-07	1.27e-02	NA
2. P	B6MFW3	Protein Hook homolog	5.77e-03	8.50e-05	NA
2. P	Q9CW79	Golgin subfamily A member 1	7.65e-08	3.85e-12	NA
2. P	O15482	Testis-specific protein TEX28	2.89e-06	1.21e-03	NA
2. P	Q8SZ63	Golgin-84	9.20e-07	4.38e-07	NA
2. P	A6NGB0	Transmembrane protein 191C	4.96e-06	8.20e-03	NA
2. P	Q60563	Synaptonemal complex protein 1 (Fragment)	6.31e-07	3.06e-02	NA
2. P	Q9WTX8	Mitotic spindle assembly checkpoint protein MAD1	5.23e-10	8.13e-08	NA
2. P	B9V5F5	Centrosomal protein of 63 kDa-A	9.93e-10	6.93e-04	NA
2. P	Q12234	GRIP domain-containing protein RUD3	4.46e-07	4.90e-04	NA
2. P	Q9JJB1	Transmembrane protein 191C	8.27e-06	2.51e-04	NA
2. P	Q96NL6	Sodium channel and clathrin linker 1	5.33e-08	2.98e-04	NA
2. P	A8MQR0	WPP domain-interacting tail-anchored protein 2	1.07e-08	4.12e-07	NA
2. P	Q0IHE5	RILP-like protein 1	1.77e-06	2.21e-06	NA
2. P	B4PAF2	Protein hook	2.93e-06	3.36e-02	NA
2. P	Q62839	Golgin subfamily A member 2	1.67e-07	5.07e-03	NA
2. P	Q7YS99	Optineurin	7.79e-08	4.56e-02	NA
2. P	F4K1B4	Nuclear envelope-associated protein 2	5.98e-08	1.67e-09	NA
2. P	Q84WU4	Golgin candidate 3	9.19e-08	1.14e-04	NA
2. P	B5DF41	Syntaphilin	6.36e-02	3.32e-04	NA
2. P	Q05D60	Deuterosome assembly protein 1	2.08e-06	1.02e-02	NA
2. P	Q9VT70	Nuclear distribution protein nudE homolog	5.58e-06	5.33e-03	NA
2. P	Q5HZK9	Centrosomal protein of 63 kDa-B	1.22e-09	7.29e-03	NA
2. P	Q8L7S4	Microtubule-associated protein 70-2	3.89e-06	6.24e-03	NA
2. P	P32380	Spindle pole body component 110	1.61e-08	2.42e-03	NA
2. P	Q9C9N6	Protein PLASTID MOVEMENT IMPAIRED 2	2.39e-07	4.64e-03	NA
2. P	Q5FWP9	Centrosomal protein cep57l1	7.89e-03	4.12e-02	NA
2. P	Q06704	Golgin IMH1	7.28e-09	1.71e-04	NA
2. P	Q8VYU6	Golgin candidate 4	3.70e-08	3.78e-05	NA
2. P	Q865V0	Centrosomal protein of 57 kDa	1.73e-04	1.74e-02	NA
2. P	Q2KJE0	Tax1-binding protein 1 homolog	1.35e-06	1.86e-02	NA
2. P	D3ZUQ0	RILP-like protein 1	1.33e-05	5.32e-07	NA
2. P	Q7Z3E2	Coiled-coil domain-containing protein 186	1.94e-07	4.04e-03	NA
2. P	Q9SHJ6	Peroxisomal and mitochondrial division factor 2	1.12e-05	2.58e-05	NA
2. P	Q9SCT6	WEB family protein At3g51720	1.75e-05	7.36e-03	NA
2. P	B0WPU9	Protein hook	4.67e-07	6.72e-04	NA
2. P	Q8S2T0	Protein GRIP	5.34e-06	3.35e-11	NA
2. P	Q5XVA8	Uncharacterized protein At3g49055	2.19e-07	3.88e-03	NA
2. P	P87169	Spindle assembly checkpoint component mad1	3.76e-09	1.47e-03	NA
2. P	Q99MI1	ELKS/Rab6-interacting/CAST family member 1	3.91e-08	4.16e-02	NA
2. P	Q6ZP65	BICD family-like cargo adapter 1	5.25e-08	1.21e-04	NA
2. P	A0PJT0	RILP-like protein 1	2.38e-05	6.60e-06	NA
2. P	P0CK98	Coiled-coil domain-containing protein 39	1.16e-08	2.99e-03	NA
2. P	Q95XR4	Ectopic P granules protein 2	9.04e-09	9.21e-03	NA
2. P	Q8TBA6	Golgin subfamily A member 5	9.07e-06	1.00e-05	NA
2. P	O42903	GRIP domain-containing protein C119.12	7.92e-08	3.93e-02	NA
2. P	Q9LTY1	Mitotic spindle checkpoint protein MAD1	2.47e-07	7.16e-06	NA
2. P	C8Z5R8	Spindle pole body component 110	7.71e-08	3.02e-03	NA
2. P	Q8NFZ5	TNFAIP3-interacting protein 2	1.47e-07	2.66e-02	NA
2. P	Q6GNT7	Golgin subfamily A member 5	4.62e-08	1.02e-08	NA
2. P	P40688	Protein swallow	5.55e-03	1.84e-04	NA
2. P	Q6GLX3	BICD family-like cargo adapter 2	9.80e-08	1.65e-04	NA
2. P	Q59PD6	Spindle assembly checkpoint component MAD1	1.39e-11	1.21e-03	NA
2. P	Q8S8N9	Golgin candidate 1	4.78e-09	1.58e-02	NA
2. P	Q9QYE6	Golgin subfamily A member 5	3.84e-07	3.81e-06	NA
2. P	Q9ULE4	Protein FAM184B	9.40e-08	1.05e-03	NA
2. P	O15079	Syntaphilin	6.63e-02	6.36e-03	NA
2. P	Q5NVN6	Centrosomal protein of 63 kDa	8.51e-11	4.59e-06	NA
2. P	Q9Y592	Centrosomal protein of 83 kDa	9.44e-09	1.00e-05	NA
2. P	Q5TZ80	Protein Hook homolog 1	1.55e-05	4.64e-03	NA
2. P	Q5R9B3	Coiled-coil domain-containing protein 186 (Fragment)	3.54e-10	2.80e-04	NA
2. P	Q5JLY8	Golgin-84	5.72e-07	1.92e-03	NA
2. P	Q2KJ21	Calcium-binding and coiled-coil domain-containing protein 1	5.85e-07	1.15e-02	NA
2. P	Q03410	Synaptonemal complex protein 1	8.20e-08	1.82e-02	NA
2. P	Q66H89	Centrosomal protein of 83 kDa	1.47e-09	1.03e-04	NA
2. P	Q17QG3	RILP-like protein 1	4.68e-06	4.09e-08	NA
2. P	Q17AF4	Protein hook	6.12e-08	1.26e-03	NA
2. P	P90970	Golgin-84	7.03e-08	3.63e-06	NA
2. P	E1BM70	Coiled-coil domain-containing protein 39	6.08e-08	7.96e-03	NA
2. P	Q5ZJ27	Protein Hook homolog 1	5.68e-06	1.57e-03	NA
2. P	Q9UJC3	Protein Hook homolog 1	6.36e-07	1.87e-02	NA
3. B	P19137	Laminin subunit alpha-1	NA	NA	0.048
3. B	P39880	Homeobox protein cut-like 1	4.27e-05	NA	0.0
3. B	P28023	Dynactin subunit 1	2.60e-04	NA	0.018
3. B	Q9GZ69	Tropomyosin	2.30e-08	NA	0.023
3. B	O08788	Dynactin subunit 1	1.75e-01	NA	0.042
3. B	Q7SZK7	Oral-facial-digital syndrome 1 protein homolog	2.16e-06	NA	0.002
3. B	P70298	Homeobox protein cut-like 2	6.13e-04	NA	5.34e-70
3. B	Q6PCJ1	Dynactin subunit 1	4.69e-02	NA	0.002
3. B	O14529	Homeobox protein cut-like 2	1.50e-04	NA	3.34e-103
3. B	P05659	Myosin-2 heavy chain, non muscle	2.26e-07	NA	4.94e-05
3. B	P53565	Homeobox protein cut-like 1	5.56e-05	NA	0.0
3. B	P53564	Homeobox protein cut-like 1	2.27e-04	NA	0.0
3. B	Q14203	Dynactin subunit 1	1.62e-05	NA	0.047
3. B	Q9BL02	Homeobox protein cut-like ceh-44	4.42e-05	NA	5.66e-32
3. B	Q21313	Laminin-like protein epi-1	NA	NA	0.001
3. B	P35458	Dynactin subunit 1	NA	NA	0.001