Summary

Q17RH7

Homolog: P08297.
Function: Early nodulin-75.

Statistics

Total GO Annotation: 16
Unique PROST Go: 16
Unique BLAST Go: 0

Total Homologs: 16
Unique PROST Homologs: 15
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P08297 (Early nodulin-75) with a FATCAT P-Value: 0.0273 and RMSD of 5.16 angstrom. The sequence alignment identity is 4.1%.
Structural alignment shown in left. Query protein Q17RH7 colored as red in alignment, homolog P08297 colored as blue. Query protein Q17RH7 is also shown in right top, homolog P08297 showed in right bottom. They are colored based on secondary structures. 

  Q17RH7 MTHDKSWRRCSISGSTKCRCGSRIAGPNALGSGGSRSSSSSSRSILSSSILSSSIPSSSSSSSSPSSSHSSSSPSSSHSSSSPSSSSSTSSPSSSSSSSS 100
  P08297 ---------------------------------------------------------------------------------------------------- 0

  Q17RH7 SSSPSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSPSSS------G----SSPSSSNSSPSSS 190
  P08297 --------------------------------------------------------------------MTSVLHYSLLLLLLGVVILTTPVLANLKPRFF 32

  Q17RH7 SSSP---SSSSSSPSPRSSSPSSSSSSTSSPSTSSPSSSSPSSSSPSSSCPSAALGRRPQSPQ--SSHCAPFP--------------------------- 258
  P08297 YEPPPIEKPPTYEPPPFYKPPYYPPPVHHPP----PEYQPPHEKTPPEYLPPPH--EKP-PPEYLPPHEKPPPEYQPPHEKPPHENPPPEHQPPHEKPPE 125

  Q17RH7 ---------------------------------------------------------------------------------------------------- 258
  P08297 HQPPHEKPPPEYEPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEHQPPHEKPPEHQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPHEKP 225

  Q17RH7 ------------------------------------------------------------------------------------ 258
  P08297 PPEYQPPHEKPPPEHQPPHEKPPPVYPPPYEKPPPVYEPPYEKPPPVVYPPPHEKPPIYEPPPLEKPPVYNPPPYGRYPPSKKN 309

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0050901 leukocyte tethering or rolling
2. P GO:0044853 plasma membrane raft
2. P GO:0007594 puparial adhesion
2. P GO:0005576 extracellular region
2. P GO:0009530 primary cell wall
2. P GO:0050902 leukocyte adhesive activation
2. P GO:0062130 adhesive extracellular matrix
2. P GO:0001931 uropod
2. P GO:0045095 keratin filament
2. P GO:0030097 hemopoiesis
2. P GO:0005201 extracellular matrix structural constituent
2. P GO:0007568 aging
2. P GO:0042633 hair cycle
2. P GO:0050900 leukocyte migration
2. P GO:0016021 integral component of membrane
2. P GO:0009877 nodulation

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q17RH7 Putative protein TPRXL 0 4.33e-147 1.21e-108
2. P P60331 Keratin-associated protein 10-1 3.78e-01 3.82e-02 NA
2. P Q62170 P-selectin glycoprotein ligand 1 2.90e-02 2.62e-02 NA
2. P P08297 Early nodulin-75 2.73e-02 1.11e-02 NA
2. P Q9BYR4 Keratin-associated protein 4-3 9.82e-01 1.50e-02 NA
2. P P02840 Salivary glue protein Sgs-3 6.69e-02 3.07e-03 NA
2. P P0CL29 Putative uncharacterized protein YML133W-A 9.96e-01 3.35e-04 NA
2. P P0CL31 Putative uncharacterized protein YPL283W-A 9.95e-01 3.35e-04 NA
2. P P14918 Extensin 2.06e-01 2.52e-02 NA
2. P P36042 Putative uncharacterized protein YKL202W 9.39e-01 1.48e-03 NA
2. P P0CL30 Putative uncharacterized protein YNL339W-A 9.94e-01 3.35e-04 NA
2. P P05691 Circumsporozoite protein (Fragment) 4.90e-01 1.26e-02 NA
2. P P0CL28 Putative uncharacterized protein YGR296C-A 9.94e-01 3.35e-04 NA
2. P Q86JP8 Putative uncharacterized protein DDB_G0271974 2.46e-01 4.16e-02 NA
2. P P05227 Histidine-rich protein PFHRP-II 9.92e-01 3.93e-04 NA
2. P P0CL27 Putative uncharacterized protein YER190C-A 9.94e-01 3.35e-04 NA