Summary

Q17RM4

Homolog: Q8CAI1.
Function: Coiled-coil domain-containing protein 142.

Statistics

Total GO Annotation: 230
Unique PROST Go: 230
Unique BLAST Go: 0

Total Homologs: 152
Unique PROST Homologs: 150
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8CAI1 (Coiled-coil domain-containing protein 142) with a FATCAT P-Value: 1.69e-14 and RMSD of 3.26 angstrom. The sequence alignment identity is 71.3%.
Structural alignment shown in left. Query protein Q17RM4 colored as red in alignment, homolog Q8CAI1 colored as blue. Query protein Q17RM4 is also shown in right top, homolog Q8CAI1 showed in right bottom. They are colored based on secondary structures. 

  Q17RM4 MAQA-SRSGSLPPLVIVPPLRAQPGGTGEEQWERSRTGGLRWEVHCWPSGTSGGTPWWPTPADVSEDYEADAAAWRRGPA-GGGPIPPALQRLRAVLLRL 98
  Q8CAI1 MARASSSSGPLPPLANVPSSWAQPVGAGEER-DEGRRGGL---------GLLAAVS-VPCP-DFSRQ------PW--APASASGPMPFALQRLRATLLRL 80

  Q17RM4 HREREQLLQARDCAYHLQSAVRLMKTLSPGSPSGGPSPLPQWCRDLQLHPSQGAVLRIG-PGETLEPLLLARPIGLAAQCLEAVIEMQLRALGREPASPG 197
  Q8CAI1 HREREQLLRARDCARHLQAVVRLLRS---GSSAGSLS-LQQLHGDLQLCPSRGAALRLGFPG-SRETLLLTRPVGLAAQHLEAAIEMQLRSLGRTPASLG 175

  Q17RM4 LSSQLAELLFALPAYHTLQRKALSHVPGAARPFPTSRVLRLLTGERGCQVASRLDEALQGSALRDQLRRRCQEEGDLLPGLLGLVGGVAGSASCGLGLGG 297
  Q8CAI1 LTSQLAELLLALPFYHTLQGHSLNFVPGAARPFPAARVLQLLAAERGCQVADKLAEARGGSGLQEQLRRQCEQERELLPGLLGLVGGVASTDSSGLRLGG 275

  Q17RM4 AGALWSQYWTLLWAACAQSLDLNLGPWRDPRATAQQLSQALGQASLPQECEKELASLCHRLLHQSLIWSWDQGFCQALGSALGGQSSLPTS-SGTAELLQ 396
  Q8CAI1 PGALWSQYWTLLWAACAKCLDLRVGPWEDPRAMAQELSQALCQAPLPQECEKELLSLCHSLFHQSVICSWDQGFCQALGSALGGQSS-PASLSPTSELLQ 374

  Q17RM4 QLFPPLLDALREPR--LRRIFCQPADPAPVALGLCTLQTTLLWFLGRAQQYLAAWDPASFLLLIQKDLPPLLHEAEALYSLASEESLALEVEQQLGLEIQ 494
  Q8CAI1 RLFPPLLDSLRQPRPELR--LCPPAGPTPVALGLCTLQTTLLWFVGRAQQHLAAWDPGSFLLLLQKDLPPLLSAVEALSSLASEAALTLEVEQQLGLEIH 472

  Q17RM4 KLTAQIQLLPEESLSVFSQECHKQAMQGFKLYMPRGRYWRLRLCPEPPSAPSEYAGLVVRTVLEPVLQGLQGLPPQAQAPALGQALTAIVGAWLDHILTH 594
  Q8CAI1 NLTEKMQLLPKESLGLFVQECHKQATQGFKLHMPRGRYWRLRLCPEPPSDPSEYARIVVYSVLEPVLQGLQGLPPEAQAPALGQALTATLGAWLDHILTH 572

  Q17RM4 GIRFSLQGALQLKQDFGVVRELLEEEQWSLSPDLRQTLLMLSIFQQLDGALLCLLQQPLPKSQVHRRPPCCCACQEVQTTKLPSSCLNSLESLEPPLQPG 694
  Q8CAI1 GIRFSLQGALQLKQDFGVVREVLEQEQWGLSQELRQTLLSLSIFQQLDGALLCLLQQPLPKNPVHRRPPRCCLCYEVQTTELPTSSLNSLENLAPPLRLG 672

  Q17RM4 TSPAQTGQLQSTL--GGR--------GPSPEGYLVGNQQAWLALRQHQRPRWHLPFFSCLGTSPES 750
  Q8CAI1 VSPAQNTHLLSTLGGGGRGGGGGGGPGPSPEAYLVGNQQAWLALRLHQHPRWHLPFFSCLRTSPEP 738

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0005902 microvillus
2. P GO:0043029 T cell homeostasis
2. P GO:0005768 endosome
2. P GO:0016080 synaptic vesicle targeting
2. P GO:0042331 phototaxis
2. P GO:0043198 dendritic shaft
2. P GO:0030072 peptide hormone secretion
2. P GO:0007094 mitotic spindle assembly checkpoint signaling
2. P GO:0042074 cell migration involved in gastrulation
2. P GO:0007354 zygotic determination of anterior/posterior axis, embryo
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0007060 male meiosis chromosome segregation
2. P GO:0048709 oligodendrocyte differentiation
2. P GO:0036090 cleavage furrow ingression
2. P GO:0044241 lipid digestion
2. P GO:0048659 smooth muscle cell proliferation
2. P GO:0043372 positive regulation of CD4-positive, alpha-beta T cell differentiation
2. P GO:0009524 phragmoplast
2. P GO:0010008 endosome membrane
2. P GO:0032456 endocytic recycling
2. P GO:0051601 exocyst localization
2. P GO:0140591 nuclear envelope budding
2. P GO:0000132 establishment of mitotic spindle orientation
2. P GO:0007111 meiosis II cytokinesis
2. P GO:0055037 recycling endosome
2. P GO:0030010 establishment of cell polarity
2. P GO:0031209 SCAR complex
2. P GO:0030903 notochord development
2. P GO:0007110 meiosis I cytokinesis
2. P GO:0010172 embryonic body morphogenesis
2. P GO:0001756 somitogenesis
2. P GO:0048339 paraxial mesoderm development
2. P GO:0048193 Golgi vesicle transport
2. P GO:0031258 lamellipodium membrane
2. P GO:0034508 centromere complex assembly
2. P GO:0030426 growth cone
2. P GO:0006904 vesicle docking involved in exocytosis
2. P GO:0007298 border follicle cell migration
2. P GO:0051223 regulation of protein transport
2. P GO:0030032 lamellipodium assembly
2. P GO:0048668 collateral sprouting
2. P GO:0039701 microtubule-dependent intracellular transport of viral material towards cell periphery
2. P GO:1904810 negative regulation of dense core granule transport
2. P GO:0030141 secretory granule
2. P GO:0007030 Golgi organization
2. P GO:0007032 endosome organization
2. P GO:0090543 Flemming body
2. P GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
2. P GO:0060628 regulation of ER to Golgi vesicle-mediated transport
2. P GO:0030838 positive regulation of actin filament polymerization
2. P GO:2000601 positive regulation of Arp2/3 complex-mediated actin nucleation
2. P GO:0010592 positive regulation of lamellipodium assembly
2. P GO:0000149 SNARE binding
2. P GO:0006891 intra-Golgi vesicle-mediated transport
2. P GO:0140627 ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
2. P GO:0043066 negative regulation of apoptotic process
2. P GO:0007268 chemical synaptic transmission
2. P GO:0001726 ruffle
2. P GO:0005737 cytoplasm
2. P GO:0005844 polysome
2. P GO:0036063 acroblast
2. P GO:0007107 membrane addition at site of cytokinesis
2. P GO:0000301 retrograde transport, vesicle recycling within Golgi
2. P GO:0097575 lateral cell cortex
2. P GO:0016020 membrane
2. P GO:0043318 negative regulation of cytotoxic T cell degranulation
2. P GO:1902474 positive regulation of protein localization to synapse
2. P GO:0043378 positive regulation of CD8-positive, alpha-beta T cell differentiation
2. P GO:0005628 prospore membrane
2. P GO:0030011 maintenance of cell polarity
2. P GO:0005795 Golgi stack
2. P GO:0045721 negative regulation of gluconeogenesis
2. P GO:0070062 extracellular exosome
2. P GO:0006474 N-terminal protein amino acid acetylation
2. P GO:0048854 brain morphogenesis
2. P GO:0005935 cellular bud neck
2. P GO:0002687 positive regulation of leukocyte migration
2. P GO:1902716 cell cortex of growing cell tip
2. P GO:0065003 protein-containing complex assembly
2. P GO:0010016 shoot system morphogenesis
2. P GO:0000922 spindle pole
2. P GO:0007492 endoderm development
2. P GO:0098793 presynapse
2. P GO:0001181 RNA polymerase I general transcription initiation factor activity
2. P GO:0000938 GARP complex
2. P GO:0007041 lysosomal transport
2. P GO:0019068 virion assembly
2. P GO:0072659 protein localization to plasma membrane
2. P GO:0000902 cell morphogenesis
2. P GO:0001042 RNA polymerase I core binding
2. P GO:0031252 cell leading edge
2. P GO:0048340 paraxial mesoderm morphogenesis
2. P GO:0034657 GID complex
2. P GO:0060348 bone development
2. P GO:0045621 positive regulation of lymphocyte differentiation
2. P GO:0006610 ribosomal protein import into nucleus
2. P GO:0030890 positive regulation of B cell proliferation
2. P GO:0015031 protein transport
2. P GO:0030950 establishment or maintenance of actin cytoskeleton polarity
2. P GO:0030165 PDZ domain binding
2. P GO:0030295 protein kinase activator activity
2. P GO:0034101 erythrocyte homeostasis
2. P GO:0045313 rhabdomere membrane biogenesis
2. P GO:1905515 non-motile cilium assembly
2. P GO:0032588 trans-Golgi network membrane
2. P GO:0000131 incipient cellular bud site
2. P GO:0007095 mitotic G2 DNA damage checkpoint signaling
2. P GO:0090726 cortical dynamic polarity patch
2. P GO:0048213 Golgi vesicle prefusion complex stabilization
2. P GO:0007009 plasma membrane organization
2. P GO:0006869 lipid transport
2. P GO:0017119 Golgi transport complex
2. P GO:0007112 male meiosis cytokinesis
2. P GO:0006896 Golgi to vacuole transport
2. P GO:0044655 phagosome reneutralization
2. P GO:0060100 positive regulation of phagocytosis, engulfment
2. P GO:1904515 positive regulation of TORC2 signaling
2. P GO:0035748 myelin sheath abaxonal region
2. P GO:0016477 cell migration
2. P GO:0034501 protein localization to kinetochore
2. P GO:1990745 EARP complex
2. P GO:0006886 intracellular protein transport
2. P GO:0030142 COPI-coated Golgi to ER transport vesicle
2. P GO:0006903 vesicle targeting
2. P GO:0048341 paraxial mesoderm formation
2. P GO:0044091 membrane biogenesis
2. P GO:0048820 hair follicle maturation
2. P GO:0032700 negative regulation of interleukin-17 production
2. P GO:0050881 musculoskeletal movement
2. P GO:0006029 proteoglycan metabolic process
2. P GO:0048613 embryonic ectodermal digestive tract morphogenesis
2. P GO:0005915 zonula adherens
2. P GO:0016081 synaptic vesicle docking
2. P GO:0048570 notochord morphogenesis
2. P GO:0045175 basal protein localization
2. P GO:0090326 positive regulation of locomotion involved in locomotory behavior
2. P GO:0030906 retromer, cargo-selective complex
2. P GO:0016197 endosomal transport
2. P GO:0060321 acceptance of pollen
2. P GO:0007093 mitotic cell cycle checkpoint signaling
2. P GO:0001736 establishment of planar polarity
2. P GO:0017196 N-terminal peptidyl-methionine acetylation
2. P GO:0016601 Rac protein signal transduction
2. P GO:0033630 positive regulation of cell adhesion mediated by integrin
2. P GO:0016192 vesicle-mediated transport
2. P GO:1904811 positive regulation of dense core granule transport
2. P GO:1990423 RZZ complex
2. P GO:0032715 negative regulation of interleukin-6 production
2. P GO:0016028 rhabdomere
2. P GO:0009860 pollen tube growth
2. P GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
2. P GO:0030496 midbody
2. P GO:0000212 meiotic spindle organization
2. P GO:0031417 NatC complex
2. P GO:0006887 exocytosis
2. P GO:0048617 embryonic foregut morphogenesis
2. P GO:0035509 negative regulation of myosin-light-chain-phosphatase activity
2. P GO:0030218 erythrocyte differentiation
2. P GO:0051286 cell tip
2. P GO:0070939 Dsl1/NZR complex
2. P GO:0002262 myeloid cell homeostasis
2. P GO:0009846 pollen germination
2. P GO:0050850 positive regulation of calcium-mediated signaling
2. P GO:0072697 protein localization to cell cortex
2. P GO:0080008 Cul4-RING E3 ubiquitin ligase complex
2. P GO:0048219 inter-Golgi cisterna vesicle-mediated transport
2. P GO:0001782 B cell homeostasis
2. P GO:0071203 WASH complex
2. P GO:0039646 modulation by virus of host G0/G1 transition checkpoint
2. P GO:0032584 growth cone membrane
2. P GO:0003012 muscle system process
2. P GO:0006893 Golgi to plasma membrane transport
2. P GO:0045579 positive regulation of B cell differentiation
2. P GO:0009933 meristem structural organization
2. P GO:0045588 positive regulation of gamma-delta T cell differentiation
2. P GO:1990756 ubiquitin ligase-substrate adaptor activity
2. P GO:0007096 regulation of exit from mitosis
2. P GO:0031464 Cul4A-RING E3 ubiquitin ligase complex
2. P GO:0042147 retrograde transport, endosome to Golgi
2. P GO:1904841 TORC2 complex binding
2. P GO:0000070 mitotic sister chromatid segregation
2. P GO:0048471 perinuclear region of cytoplasm
2. P GO:0007269 neurotransmitter secretion
2. P GO:0000916 actomyosin contractile ring contraction
2. P GO:0007039 protein catabolic process in the vacuole
2. P GO:0098794 postsynapse
2. P GO:0030031 cell projection assembly
2. P GO:0010015 root morphogenesis
2. P GO:0005828 kinetochore microtubule
2. P GO:0035262 gonad morphogenesis
2. P GO:0048812 neuron projection morphogenesis
2. P GO:0042102 positive regulation of T cell proliferation
2. P GO:0042327 positive regulation of phosphorylation
2. P GO:0055108 Golgi to transport vesicle transport
2. P GO:1902624 positive regulation of neutrophil migration
2. P GO:0005794 Golgi apparatus
2. P GO:0090023 positive regulation of neutrophil chemotaxis
2. P GO:1901046 positive regulation of oviposition
2. P GO:0048507 meristem development
2. P GO:0000120 RNA polymerase I transcription regulator complex
2. P GO:0016021 integral component of membrane
2. P GO:0031267 small GTPase binding
2. P GO:0043332 mating projection tip
2. P GO:0008078 mesodermal cell migration
2. P GO:0030866 cortical actin cytoskeleton organization
2. P GO:0045648 positive regulation of erythrocyte differentiation
2. P GO:0090522 vesicle tethering involved in exocytosis
2. P GO:0019902 phosphatase binding
2. P GO:0005829 cytosol
2. P GO:0047485 protein N-terminus binding
2. P GO:0005811 lipid droplet
2. P GO:0030667 secretory granule membrane
2. P GO:1904019 epithelial cell apoptotic process
2. P GO:0000145 exocyst
2. P GO:0035544 negative regulation of SNARE complex assembly
2. P GO:0035050 embryonic heart tube development
2. P GO:0010517 regulation of phospholipase activity
2. P GO:2000370 positive regulation of clathrin-dependent endocytosis
2. P GO:0030133 transport vesicle
2. P GO:0070358 actin polymerization-dependent cell motility
2. P GO:0001927 exocyst assembly
2. P GO:0000139 Golgi membrane
2. P GO:0060378 regulation of brood size
2. P GO:0006361 transcription initiation from RNA polymerase I promoter
2. P GO:0005934 cellular bud tip
2. P GO:0000776 kinetochore
2. P GO:0051233 spindle midzone
2. P GO:0007290 spermatid nucleus elongation
2. P GO:0031941 filamentous actin
2. P GO:0045176 apical protein localization

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q17RM4 Coiled-coil domain-containing protein 142 0 1.64e-116 0.0
1. PB Q8CAI1 Coiled-coil domain-containing protein 142 1.69e-14 1.25e-57 0.0
2. P Q62824 Exocyst complex component 4 7.07e-05 1.76e-03 NA
2. P Q9UI26 Importin-11 3.73e-03 4.75e-02 NA
2. P Q5ZKV9 Syndetin 1.99e-05 1.58e-05 NA
2. P Q21270 Conserved oligomeric Golgi complex subunit 6 3.91e-05 1.57e-02 NA
2. P Q6DKG0 N-alpha-acetyltransferase 35, NatC auxiliary subunit 3.91e-04 4.67e-08 NA
2. P Q8TEL6 Short transient receptor potential channel 4-associated protein 3.58e-03 2.79e-02 NA
2. P B0S6R1 Nck-associated protein 1 4.57e-03 1.68e-05 NA
2. P Q6CUV9 DNA damage checkpoint protein LCD1 5.76e-03 1.54e-02 NA
2. P Q9JLV2 Short transient receptor potential channel 4-associated protein 1.43e-02 9.44e-03 NA
2. P O36413 Inner tegument protein NA 1.20e-03 NA
2. P Q06096 Conserved oligomeric Golgi complex subunit 4 9.42e-06 2.89e-03 NA
2. P Q03169 Tumor necrosis factor alpha-induced protein 2 4.55e-05 3.11e-11 NA
2. P Q9XTM1 Exocyst complex component 5 4.11e-07 3.38e-03 NA
2. P Q8R1U1 Conserved oligomeric Golgi complex subunit 4 7.52e-06 5.59e-06 NA
2. P Q8BI71 Exocyst complex component 3-like protein 9.45e-06 1.80e-09 NA
2. P Q54R74 WASH complex subunit 4 8.81e-04 8.63e-05 NA
2. P Q0WQF4 Vacuolar protein sorting-associated protein 53 A 1.27e-05 2.50e-02 NA
2. P Q9SY60 Exocyst complex component EXO84C 1.04e-05 7.43e-05 NA
2. P Q9FGN0 Conserved oligomeric Golgi complex subunit 7 2.52e-06 4.48e-02 NA
2. P Q9V8K2 Exocyst complex component 3 2.01e-06 7.99e-07 NA
2. P Q9VNH6 Exocyst complex component 4 3.28e-03 4.51e-03 NA
2. P B4F766 Dymeclin 2.11e-03 2.27e-02 NA
2. P A1CU89 Conserved oligomeric Golgi complex subunit 6 2.88e-05 3.42e-02 NA
2. P Q19642 Centromere/kinetochore protein zw10 homolog 2.06e-06 1.23e-04 NA
2. P Q2M389 WASH complex subunit 4 9.12e-03 6.28e-03 NA
2. P O13986 Uncharacterized protein C26H5.04 3.04e-03 2.16e-02 NA
2. P P89102 Exocyst complex component SEC5 5.07e-06 1.83e-03 NA
2. P P97878 Exocyst complex component 5 2.28e-06 1.32e-02 NA
2. P Q5R7R6 Conserved oligomeric Golgi complex subunit 4 1.49e-06 5.65e-06 NA
2. P P34561 Vacuolar protein sorting-associated protein 53 homolog 2.06e-05 1.47e-05 NA
2. P Q6PHQ8 N-alpha-acetyltransferase 35, NatC auxiliary subunit 7.77e-04 2.46e-08 NA
2. P Q9USY3 N-alpha-acetyltransferase 35, NatC auxiliary subunit 4.85e-04 1.22e-03 NA
2. P Q6NUQ1 RAD50-interacting protein 1 2.65e-06 1.84e-09 NA
2. P Q640K3 Nck-associated protein 1 4.30e-03 2.29e-05 NA
2. P Q8L838 Conserved oligomeric Golgi complex subunit 4 7.70e-06 8.37e-05 NA
2. P Q18286 Exocyst complex component 6 2.36e-05 2.67e-02 NA
2. P A6QQ47 Vacuolar protein sorting-associated protein 51 homolog 4.05e-05 3.35e-06 NA
2. P A2AV37 Exocyst complex component 3-like protein 8.65e-06 4.14e-05 NA
2. P Q9VJD3 Conserved oligomeric Golgi complex subunit 5 3.16e-05 2.24e-05 NA
2. P Q8BZ36 RAD50-interacting protein 1 1.31e-05 7.50e-08 NA
2. P Q9Y2A7 Nck-associated protein 1 5.03e-03 8.75e-04 NA
2. P Q95XZ0 Conserved oligomeric Golgi complex subunit 4 2.75e-06 1.79e-07 NA
2. P Q4V9Y0 Vacuolar protein sorting-associated protein 51 homolog 9.19e-06 1.90e-03 NA
2. P Q54VZ8 Exocyst complex component 8 2.61e-06 9.71e-04 NA
2. P Q5VZE5 N-alpha-acetyltransferase 35, NatC auxiliary subunit 1.04e-03 4.91e-07 NA
2. P Q7S4D8 Conserved oligomeric Golgi complex subunit 6 1.09e-04 1.08e-03 NA
2. P O54692 Centromere/kinetochore protein zw10 homolog 1.26e-06 2.06e-04 NA
2. P Q3TPX4 Exocyst complex component 5 1.64e-06 1.29e-02 NA
2. P Q5R974 Importin-13 1.02e-03 3.36e-02 NA
2. P A6H5Z3 Exocyst complex component 6B 1.28e-04 9.22e-07 NA
2. P Q54BP6 Exocyst complex component 3 5.60e-06 9.00e-04 NA
2. P Q94AI6 Exocyst complex component SEC6 1.19e-06 3.45e-05 NA
2. P Q9VGC3 Conserved oligomeric Golgi complex subunit 1 4.47e-05 9.99e-04 NA
2. P P32844 Exocyst complex component SEC6 1.26e-06 1.73e-03 NA
2. P Q9VDE6 Exocyst complex component 6 1.36e-04 4.05e-02 NA
2. P Q8AYS7 Centromere protein I 5.55e-03 7.91e-03 NA
2. P Q8WTW3 Conserved oligomeric Golgi complex subunit 1 1.30e-04 4.53e-05 NA
2. P Q9Z160 Conserved oligomeric Golgi complex subunit 1 9.73e-05 3.72e-04 NA
2. P Q6DCP6 Dymeclin 9.78e-03 6.87e-03 NA
2. P Q0V8C2 Exocyst complex component 3 1.26e-06 1.62e-03 NA
2. P P40547 Vacuolar import and degradation protein 28 2.68e-03 4.83e-02 NA
2. P Q5RFM4 Centromere/kinetochore protein zw10 homolog 1.68e-06 3.70e-03 NA
2. P Q9VI25 Neurochondrin homolog 2.60e-04 8.34e-03 NA
2. P Q9C0W8 Protein transport protein tip20 2.70e-06 4.25e-08 NA
2. P P47061 Vacuolar protein sorting-associated protein 53 2.99e-05 2.56e-02 NA
2. P Q5ASE3 Exportin-T 3.03e-03 3.51e-02 NA
2. P Q96JG6 Syndetin 3.25e-04 6.92e-05 NA
2. P Q17RC7 Exocyst complex component 3-like protein 4 6.89e-06 1.47e-12 NA
2. P F1LSG8 Syndetin 1.68e-04 9.00e-04 NA
2. P Q28BM0 Dymeclin 3.10e-03 7.91e-03 NA
2. P Q61333 Tumor necrosis factor alpha-induced protein 2 1.06e-04 3.03e-11 NA
2. P Q10110 RNA polymerase I-specific transcription initiation factor rrn3 5.18e-03 1.13e-02 NA
2. P D1ZSG5 Nucleolar protein 9 3.62e-03 1.10e-02 NA
2. P O48626 Centromere/kinetochore protein zw10 homolog 6.13e-06 4.06e-05 NA
2. P O44218 Centromere/kinetochore protein zw10 4.12e-06 1.52e-04 NA
2. P Q8RX56 Protein unc-13 homolog 5.74e-04 9.34e-05 NA
2. P Q6KAR6 Exocyst complex component 3 2.53e-06 1.09e-03 NA
2. P Q9LXX6 Exocyst complex component SEC15A 1.32e-05 8.35e-07 NA
2. P Q9W1A2 N-alpha-acetyltransferase 35, NatC auxiliary subunit homolog 9.86e-04 2.46e-05 NA
2. P P55161 Nck-associated protein 1 4.55e-03 8.51e-04 NA
2. P P55163 Membrane-associated protein gex-3 1.57e-03 3.52e-05 NA
2. P Q9XWS2 Exocyst complex component 4 2.29e-06 3.90e-04 NA
2. P P87129 Vacuolar protein sorting-associated protein 53 2.34e-05 1.63e-04 NA
2. P Q8S3U9 Exocyst complex component SEC5A 2.19e-05 7.91e-03 NA
2. P O35382 Exocyst complex component 4 2.27e-04 9.99e-04 NA
2. P Q505L3 Vacuolar protein sorting-associated protein 51 homolog 6.12e-06 2.16e-02 NA
2. P X5JA13 Exocyst complex component SEC10a 8.43e-06 4.08e-02 NA
2. P Q8TAG9 Exocyst complex component 6 7.63e-05 1.59e-06 NA
2. P Q86VI1 Exocyst complex component 3-like protein 9.43e-06 2.00e-10 NA
2. P Q18406 Exocyst complex component 5 3.10e-07 3.82e-04 NA
2. P Q7KNA0 Dymeclin 5.37e-03 1.52e-03 NA
2. P Q55FT5 Conserved oligomeric Golgi complex subunit 4 1.22e-04 1.17e-03 NA
2. P Q8CHY3 Dymeclin 6.66e-03 2.14e-04 NA
2. P F4JHH5 Exocyst complex component SEC15B 3.07e-05 5.15e-04 NA
2. P O01839 Vacuolar protein sorting-associated protein 51 homolog 8.64e-05 5.85e-03 NA
2. P O44219 Centromere/kinetochore protein zw10 3.41e-06 3.69e-02 NA
2. P P38315 YAP1-binding protein 1 6.14e-04 3.70e-05 NA
2. P Q5ZLW3 Dymeclin 2.22e-02 1.21e-02 NA
2. P P55160 Nck-associated protein 1-like 5.97e-03 3.85e-02 NA
2. P F4I0P8 Vacuolar protein sorting-associated protein 35B 1.02e-03 2.50e-03 NA
2. P P22224 Exocyst complex component SEC15 2.34e-05 1.35e-04 NA
2. P Q7RTS9 Dymeclin 4.99e-03 1.44e-03 NA
2. P O54923 Exocyst complex component 6 6.22e-05 1.46e-06 NA
2. P Q92674 Centromere protein I 1.04e-02 1.12e-02 NA
2. P Q8CI71 Syndetin 2.16e-02 1.55e-04 NA
2. P Q4R708 N-alpha-acetyltransferase 35, NatC auxiliary subunit 7.27e-04 2.90e-07 NA
2. P Q3UVL4 Vacuolar protein sorting-associated protein 51 homolog 1.86e-05 1.11e-04 NA
2. P P28660 Nck-associated protein 1 4.37e-03 5.20e-04 NA
2. P O13705 Exocyst complex component sec10 3.05e-06 1.28e-02 NA
2. P Q9Y2D4 Exocyst complex component 6B 6.98e-05 1.79e-07 NA
2. P Q4V8C2 Centromere/kinetochore protein zw10 homolog 5.46e-06 1.22e-03 NA
2. P Q6DIA2 Exocyst complex component 3-like protein 4 6.12e-06 2.27e-13 NA
2. P Q8K1X4 Nck-associated protein 1-like 6.69e-03 3.89e-05 NA
2. P F4KG58 Exocyst complex component EXO70A3 5.19e-03 2.03e-02 NA
2. P Q29RB1 Conserved oligomeric Golgi complex subunit 4 7.09e-06 2.59e-06 NA
2. P Q66665 Inner tegument protein NA 2.16e-02 NA
2. P Q9UP83 Conserved oligomeric Golgi complex subunit 5 9.68e-05 2.43e-04 NA
2. P Q0VCR8 Exocyst complex component 3-like protein 6.64e-06 3.51e-09 NA
2. P Q155U0 Vacuolar protein sorting-associated protein 51 homolog 1.28e-04 7.97e-04 NA
2. P Q640K1 Neurochondrin 3.17e-04 3.01e-02 NA
2. P O74990 Conserved oligomeric Golgi complex subunit 4 1.08e-04 2.09e-05 NA
2. P Q5AKU3 CAP1-binding-protein 2.96e-04 1.25e-02 NA
2. P E2R766 Exocyst complex component 6 8.79e-05 5.78e-05 NA
2. P Q9H9E3 Conserved oligomeric Golgi complex subunit 4 5.59e-06 1.43e-06 NA
2. P Q9VS46 RINT1-like protein 1.08e-06 9.22e-08 NA
2. P O43264 Centromere/kinetochore protein zw10 homolog 1.77e-05 1.58e-03 NA
2. P O74846 Exocyst complex component sec6 2.12e-06 1.96e-07 NA
2. P Q3MHG0 Conserved oligomeric Golgi complex subunit 4 1.45e-06 4.11e-06 NA
2. P Q8K0C1 Importin-13 9.52e-04 2.39e-02 NA
2. P O75006 Exocyst complex component sec15 5.35e-07 1.59e-02 NA
2. P Q8R313 Exocyst complex component 6 2.47e-06 1.14e-04 NA
2. P P39531 Recyclin-1 2.93e-06 7.65e-05 NA
2. P Q6SWA4 Protein UL27 NA 2.31e-02 NA
2. P Q9UID3 Vacuolar protein sorting-associated protein 51 homolog 1.94e-04 1.11e-04 NA
2. P Q62825 Exocyst complex component 3 3.75e-05 2.87e-03 NA
2. P Q8GXP1 RINT1-like protein MAG2L 9.97e-07 4.12e-03 NA
2. P Q5ZJ25 Vacuolar protein sorting-associated protein 51 homolog 3.53e-04 1.68e-03 NA
2. P Q96A65 Exocyst complex component 4 7.16e-05 4.80e-03 NA
2. P Q9W4X9 Centromere/kinetochore protein zw10 9.57e-05 1.21e-02 NA
2. P Q8C0L8 Conserved oligomeric Golgi complex subunit 5 4.91e-06 2.12e-03 NA
2. P Q5RAW5 Dymeclin 2.10e-02 1.97e-03 NA
2. P Q3UMB9 WASH complex subunit 4 3.02e-03 2.24e-03 NA
2. P O00471 Exocyst complex component 5 1.62e-06 8.88e-03 NA
2. P Q293C2 Dymeclin 1.08e-02 5.25e-03 NA
2. P Q5ZHV2 N-alpha-acetyltransferase 35, NatC auxiliary subunit 4.95e-04 3.21e-07 NA
2. P Q95TN4 Conserved oligomeric Golgi complex subunit 4 1.88e-06 7.15e-07 NA
2. P Q7T322 N-alpha-acetyltransferase 35, NatC auxiliary subunit 5.31e-04 4.59e-07 NA
2. P Q9C9V9 Conserved oligomeric Golgi complex subunit 5 5.48e-05 2.73e-04 NA
2. P Q9P1Q0 Vacuolar protein sorting-associated protein 54 4.25e-04 3.57e-02 NA
2. P Q5RBT3 N-alpha-acetyltransferase 35, NatC auxiliary subunit 7.10e-04 4.91e-07 NA