Summary

Q1A5X6

Homolog: Q8BPW0.
Function: IQ domain-containing protein J.

Statistics

Total GO Annotation: 9
Unique PROST Go: 0
Unique BLAST Go: 9

Total Homologs: 4
Unique PROST Homologs: 0
Unique BLAST Homologs: 3

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q8BPW0 (IQ domain-containing protein J) with a FATCAT P-Value: 0.0224 and RMSD of 4.13 angstrom. The sequence alignment identity is 57.5%.
Structural alignment shown in left. Query protein Q1A5X6 colored as red in alignment, homolog Q8BPW0 colored as blue. Query protein Q1A5X6 is also shown in right top, homolog Q8BPW0 showed in right bottom. They are colored based on secondary structures.

  Q1A5X6 MRLEELKRLQNPLEQVNDGKYSFENHQLAMDAENNIEKYPLNLQPLESKVKIIQRAWREYLQRQEPLGKRSPSPPSVSSEKLSSSVSMNTFSDSSTPFAR 100
  Q8BPW0 MRLEELKRLQNPLEQVDDGKYLLENHQLAMDVENNIENYPLSLQPLESKVKIIQRAWREYLQRQDPLEKRSPSPPSVSSDKLSSSVSMNTFSDSSTPVS- 99

  Q1A5X6 APVGKIHPYISWR-LQSPGDKLPGGRKVILLYLDQLARPTGFIHTLKEPQIERLGFLTLQ 159
  Q8BPW0 --VSR--P-LAWTVLH-------------------------------------------- 110

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
3. B GO:0043194 axon initial segment
3. B GO:0033268 node of Ranvier
3. B GO:0044325 transmembrane transporter binding
3. B GO:0051494 negative regulation of cytoskeleton organization
3. B GO:0030054 cell junction
3. B GO:0005516 calmodulin binding
3. B GO:0035332 positive regulation of hippo signaling
3. B GO:0008366 axon ensheathment
3. B GO:0030506 ankyrin binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q1A5X6 IQ domain-containing protein J 0 3.86e-139 1.29e-114
3. B B3KU38 IQCJ-SCHIP1 readthrough transcript protein 6.77e-01 NA 1.62e-60
3. B A0A088MLT8 IQCJ-SCHIP1 readthrough transcript protein 5.12e-01 NA 2.97e-40
3. B Q8BPW0 IQ domain-containing protein J 2.24e-02 NA 1.95e-44