Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q80YR3
(SKI/DACH domain-containing protein 1) with a FATCAT P-Value: 1.79e-05 and RMSD of 19.73 angstrom. The sequence alignment identity is 83.6%.
Structural alignment shown in left. Query protein Q1XH10 colored as red in alignment, homolog Q80YR3 colored as blue.
Query protein Q1XH10 is also shown in right top, homolog Q80YR3 showed in right bottom. They are colored based on secondary structures.
Q1XH10 MGDLKSGFEEVDGVRLGYLIIKGKQMFALSQVFTDLLKNIPRTTVHKRMDHLKVKKHHCDLEELRKLKAINSIAFHAAKCTLISREDVEALYTSCKTERV 100 Q80YR3 MGDLKSGFEEVDGVRLGYLIIKGKQMFALSQVFTDLLKNIPRTTVHKRMDHLKVKKHHCDLEELRKLKAINSIAFHAAKCTLISREDVEALYTSCKTERV 100 Q1XH10 LKTKRRRVGRALATKAPPPERAAAASPRPGFWKDKHQLWRGLSGAARPLPISAQSQRPGAAAARPAAHLPQIFSKYPGSHYPEIVRSPCKPPLNYETAPL 200 Q80YR3 LKTKRRRVGRALATKAPPPERAAAASPRPAFWKDKHQLWRGLSGAARPLPISAQSQRPGAAAARPAAHLPQIFSKYPGSHYPEIVRSPCKSSLNYETAQL 200 Q1XH10 QGNYVAFPSDPAYFRSLLCSKHPAAAAAAAAAAAAAAAAAAAAAYYQVSAAGPQPKAAAGAGGPGSLSYRCKRKRGGAKDCLLAPHAGARRLLLLPRSYK 300 Q80YR3 QGNYVAFHSDPAYFRSLLCSKHP----------------------------------------------------------------------------- 223 Q1XH10 AKAAAAAAAAAAAAAAAAGATCLERFHLVNGFCPPPHHHHHHHHHHHHHHHRAQPPQQSHHPPHHHRPQPHLGSFPESCSSDSESSSYSDHAANDSDFGS 400 Q80YR3 ---------------AAAGATCLERFHLVNSFCPPPHHHHHHHHHHHHHHHRAQQPTPSHHPSHHHRPQPHLGSFPESCSSDSESSSYSDHAANDSDFGS 308 Q1XH10 SLSSSSNSVSSEEEEEEG-EEEEEEEEEEGGSGASDSSEVSSEEEDSSTESDSSSGSSQVSVQSIRFRRTSFCKPPSVQAQANFLYHLASAAAATKPAAF 499 Q80YR3 SLSSSSNSVSSEEEEEEGEEEEEEEEEEEGGSGASDSSEISSEEEDSSTESDSSSGSSQVSVQSIRFRRTSFCKPPSVQAQANFLYHLASAAAATKPAAF 408 Q1XH10 EDAGRLPDLKSSVKAESPAEWNLQSWAPKASPVYCPASLGSCFAEIRNDRVSEITFPHSEISNAVKRTDLTINCLAEGASSPSPKTNNAFPQQRILREAR 599 Q80YR3 EDAGRLPDLKSSVKAESPEEWSLQSWAPKGTPVYCPASLGSCFPEIRNDRVSEITFPHSEISSTVKRTDLTINCHAEGASSPSPKTNNVFPQQRILREAR 508 Q1XH10 KCLQTTPTTHCADNNTIAARFLNNDSSGAEANSEKYSKILHCPEFATDLPSSQTDPEVN-----AAGAAATKAENPCTDTGDKTLPFLHNIKIKVEDSSA 694 Q80YR3 KCLQATPTTHCAENSTIAARFLNNDSCGTTANSGKDSKIPHCPEFATDLPSLQSDPRVDTATAAAAAAAATKAESLCTGTGDKTLPFLHNIKIKVEDSSA 608 Q1XH10 NEEYEPHLFTNKLKCECNDTKGEFYSVTESKEEDALLTTAKEGFACPEKETPSLNPLAQSQGLSCTLGSPKPEDGEYKFGARVRKNYRTLVLGKRPVLQT 794 Q80YR3 NEEYEPELITNKLKWECNDAEGEFYNMTEKKEEDALVPTAKEGFACPEKETPSLNPLAQSQGLSCTLGSPKPEDGEYKFGARVRKNYRTLVLGKRPVLQT 708 Q1XH10 PPVKPNLKSARSPRPTGKTETNEGTLDDFTVINRRKKVASNVASAVKRPFHFMANFPCPPSLIIGRDGDLWPAYSLNTTKDSQTPHKAHPIWKWQLGGSA 894 Q80YR3 PPVKPNLKSARSPRPTGKTETHEGTLDDFTVLNRRKKVASNVASAVKRPFNFMANFPCPPSLIIGKDGDLWPAYSLNTTKDSQPPHKAHPIWKWQLGGSA 808 Q1XH10 IPLPPSHKFRKFNS 908 Q80YR3 IPLPPSHKFRKFNS 822
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005634 | nucleus |
| 2. P | GO:0009306 | protein secretion |
| 2. P | GO:0009960 | endosperm development |
| 2. P | GO:0120162 | positive regulation of cold-induced thermogenesis |
| 2. P | GO:0005876 | spindle microtubule |
| 2. P | GO:0007565 | female pregnancy |
| 2. P | GO:0034501 | protein localization to kinetochore |
| 2. P | GO:0000712 | resolution of meiotic recombination intermediates |
| 2. P | GO:0034503 | protein localization to nucleolar rDNA repeats |
| 2. P | GO:0045121 | membrane raft |
| 2. P | GO:1990758 | mitotic sister chromatid biorientation |
| 2. P | GO:0006879 | cellular iron ion homeostasis |
| 2. P | GO:0043486 | histone exchange |
| 2. P | GO:0071107 | response to parathyroid hormone |
| 2. P | GO:0072686 | mitotic spindle |
| 2. P | GO:0035861 | site of double-strand break |
| 2. P | GO:0006302 | double-strand break repair |
| 2. P | GO:0000812 | Swr1 complex |
| 2. P | GO:0023052 | signaling |
| 2. P | GO:0040015 | negative regulation of multicellular organism growth |
| 2. P | GO:0051016 | barbed-end actin filament capping |
| 2. P | GO:0009793 | embryo development ending in seed dormancy |
| 2. P | GO:1990385 | meiotic spindle midzone |
| 2. P | GO:0030133 | transport vesicle |
| 2. P | GO:0051726 | regulation of cell cycle |
| 2. P | GO:0140429 | positive regulation of mitotic sister chromatid biorientation |
| 2. P | GO:0005721 | pericentric heterochromatin |
| 2. P | GO:0044182 | filamentous growth of a population of unicellular organisms |
| 2. P | GO:0030479 | actin cortical patch |
| 2. P | GO:0000776 | kinetochore |
| 2. P | GO:1990023 | mitotic spindle midzone |
| 2. P | GO:0032133 | chromosome passenger complex |
| 2. P | GO:1902412 | regulation of mitotic cytokinesis |
| 2. P | GO:0044732 | mitotic spindle pole body |
| 2. P | GO:0000070 | mitotic sister chromatid segregation |
| 2. P | GO:0006878 | cellular copper ion homeostasis |
| 3. B | GO:0033262 | regulation of nuclear cell cycle DNA replication |
| 3. B | GO:0001227 | DNA-binding transcription repressor activity, RNA polymerase II-specific |
| 3. B | GO:0060021 | roof of mouth development |
| 3. B | GO:0048593 | camera-type eye morphogenesis |
| 3. B | GO:0030326 | embryonic limb morphogenesis |
| 3. B | GO:0019904 | protein domain specific binding |
| 3. B | GO:0070449 | elongin complex |
| 3. B | GO:0030177 | positive regulation of Wnt signaling pathway |
| 3. B | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 3. B | GO:0045892 | negative regulation of transcription, DNA-templated |
| 3. B | GO:0008283 | cell population proliferation |
| 3. B | GO:0045668 | negative regulation of osteoblast differentiation |
| 3. B | GO:0046545 | development of primary female sexual characteristics |
| 3. B | GO:0007585 | respiratory gaseous exchange by respiratory system |
| 3. B | GO:0031625 | ubiquitin protein ligase binding |
| 3. B | GO:0032926 | negative regulation of activin receptor signaling pathway |
| 3. B | GO:0010626 | negative regulation of Schwann cell proliferation |
| 3. B | GO:0022011 | myelination in peripheral nervous system |
| 3. B | GO:0048663 | neuron fate commitment |
| 3. B | GO:0009948 | anterior/posterior axis specification |
| 3. B | GO:0048814 | regulation of dendrite morphogenesis |
| 3. B | GO:0048741 | skeletal muscle fiber development |
| 3. B | GO:0008285 | negative regulation of cell population proliferation |
| 3. B | GO:0048147 | negative regulation of fibroblast proliferation |
| 3. B | GO:0021936 | regulation of cerebellar granule cell precursor proliferation |
| 3. B | GO:0043585 | nose morphogenesis |
| 3. B | GO:0030425 | dendrite |
| 3. B | GO:0001843 | neural tube closure |
| 3. B | GO:0060395 | SMAD protein signal transduction |
| 3. B | GO:0048870 | cell motility |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:0043010 | camera-type eye development |
| 3. B | GO:0000977 | RNA polymerase II transcription regulatory region sequence-specific DNA binding |
| 3. B | GO:0140297 | DNA-binding transcription factor binding |
| 3. B | GO:0035019 | somatic stem cell population maintenance |
| 3. B | GO:0060244 | negative regulation of cell proliferation involved in contact inhibition |
| 3. B | GO:0001967 | suckling behavior |
| 3. B | GO:0003682 | chromatin binding |
| 3. B | GO:0030336 | negative regulation of cell migration |
| 3. B | GO:0060349 | bone morphogenesis |
| 3. B | GO:0048863 | stem cell differentiation |
| 3. B | GO:0021587 | cerebellum morphogenesis |
| 3. B | GO:0006357 | regulation of transcription by RNA polymerase II |
| 3. B | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding |
| 3. B | GO:0005667 | transcription regulator complex |
| 3. B | GO:0060041 | retina development in camera-type eye |
| 3. B | GO:1990837 | sequence-specific double-stranded DNA binding |
| 3. B | GO:0019901 | protein kinase binding |
| 3. B | GO:0000981 | DNA-binding transcription factor activity, RNA polymerase II-specific |
| 3. B | GO:0002089 | lens morphogenesis in camera-type eye |
| 3. B | GO:0010944 | negative regulation of transcription by competitive promoter binding |
| 3. B | GO:0016605 | PML body |
| 3. B | GO:0017053 | transcription repressor complex |
| 3. B | GO:0046332 | SMAD binding |
| 3. B | GO:0030514 | negative regulation of BMP signaling pathway |
| 3. B | GO:0021772 | olfactory bulb development |
| 3. B | GO:0043025 | neuronal cell body |
| 3. B | GO:0043388 | positive regulation of DNA binding |
| 3. B | GO:0048468 | cell development |
| 3. B | GO:0046811 | histone deacetylase inhibitor activity |
| 3. B | GO:0035098 | ESC/E(Z) complex |
| 3. B | GO:0005694 | chromosome |
| 3. B | GO:0014902 | myotube differentiation |
| 3. B | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway |
| 3. B | GO:0035616 | histone H2B conserved C-terminal lysine deubiquitination |
| 3. B | GO:2000279 | negative regulation of DNA biosynthetic process |
| 3. B | GO:0070208 | protein heterotrimerization |
| 3. B | GO:0021702 | cerebellar Purkinje cell differentiation |
| 3. B | GO:0045880 | positive regulation of smoothened signaling pathway |
| 3. B | GO:0060325 | face morphogenesis |
| 3. B | GO:0006351 | transcription, DNA-templated |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q80YR3 | SKI/DACH domain-containing protein 1 | 1.79e-05 | 1.37e-59 | 0.0 |
| 1. PB | Q1XH10 | SKI/DACH domain-containing protein 1 | 0 | 2.78e-165 | 0.0 |
| 2. P | O95467 | Neuroendocrine secretory protein 55 | 5.18e-01 | 3.85e-02 | NA |
| 2. P | Q5AFK0 | Metal-binding activator 1 | 5.81e-01 | 4.33e-02 | NA |
| 2. P | O14064 | Protein bir1 | 1.36e-01 | 1.95e-02 | NA |
| 2. P | O74939 | Uncharacterized protein C553.01c | 7.85e-02 | 1.53e-02 | NA |
| 2. P | Q6CKU6 | SWR1-complex protein 3 | 5.40e-01 | 3.17e-02 | NA |
| 2. P | A7MB40 | Protein FAM193B | 3.09e-01 | 1.89e-02 | NA |
| 2. P | O54931 | A-kinase anchor protein 2 | 2.39e-01 | 4.96e-02 | NA |
| 2. P | C5DL76 | Altered inheritance of mitochondria protein 3 | 1.11e-01 | 1.60e-03 | NA |
| 2. P | F4JRR5 | TITAN-like protein | 6.35e-01 | 3.48e-03 | NA |
| 3. B | P17863 | Transforming protein Ski | NA | NA | 0.002 |
| 3. B | Q7TNS8 | Elongin BC and Polycomb repressive complex 2-associated protein | 3.66e-01 | NA | 4.06e-11 |
| 3. B | A7M7C7 | SKI family transcriptional corepressor 2 | 2.83e-02 | NA | 0.001 |
| 3. B | P12755 | Ski oncogene | 3.96e-01 | NA | 0.003 |
| 3. B | Q60698 | Ski oncogene | 1.27e-01 | NA | 0.003 |
| 3. B | Q9QYB2 | Dachshund homolog 1 | 2.19e-03 | NA | 1.16e-06 |
| 3. B | P49140 | Ski oncogene | 2.01e-01 | NA | 0.006 |
| 3. B | Q8BX46 | SKI family transcriptional corepressor 1 | 8.85e-02 | NA | 0.002 |
| 3. B | A6NHQ4 | Elongin BC and Polycomb repressive complex 2-associated protein | 1.35e-01 | NA | 3.88e-14 |
| 3. B | Q9UI36 | Dachshund homolog 1 | 3.99e-02 | NA | 1.13e-06 |
| 3. B | Q9TUG2 | Ski oncogene | 1.13e-01 | NA | 0.010 |
| 3. B | Q02225 | Ski oncogene | 1.39e-01 | NA | 0.007 |
| 3. B | Q925Q8 | Dachshund homolog 2 | 2.89e-02 | NA | 5.50e-09 |
| 3. B | H2KY91 | Dachshund homolog dac-1 | 1.30e-02 | NA | 4.20e-05 |
| 3. B | P84551 | SKI family transcriptional corepressor 1 | 8.89e-02 | NA | 0.002 |
| 3. B | Q1LXZ9 | SKI family transcriptional corepressor 1 homolog-B | 2.78e-02 | NA | 0.007 |
| 3. B | P84550 | SKI family transcriptional corepressor 1 | 6.48e-02 | NA | 0.001 |
| 3. B | Q96NX9 | Dachshund homolog 2 | 5.28e-02 | NA | 1.73e-08 |
| 3. B | Q2VWA4 | SKI family transcriptional corepressor 2 | 2.06e-02 | NA | 0.002 |