Summary

Q2M3V2

Homolog: Q8BLS7.
Function: Ankyrin repeat domain-containing protein SOWAHA.

Statistics

Total GO Annotation: 408
Unique PROST Go: 28
Unique BLAST Go: 375

Total Homologs: 206
Unique PROST Homologs: 12
Unique BLAST Homologs: 187

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8BLS7 (Ankyrin repeat domain-containing protein SOWAHA) with a FATCAT P-Value: 1.89e-08 and RMSD of 5.72 angstrom. The sequence alignment identity is 76.7%.
Structural alignment shown in left. Query protein Q2M3V2 colored as red in alignment, homolog Q8BLS7 colored as blue. Query protein Q2M3V2 is also shown in right top, homolog Q8BLS7 showed in right bottom. They are colored based on secondary structures. 

  Q2M3V2 MAL--AAAAAAAAAGVSQAAVLGFLQEHGGKVRNSELLSRFKPLLDAGDPRGRAARRDRFKQFVNNVAVVKELDGVKFVVLRKKPRPPE-PE-PAPFGP- 95
  Q8BLS7 MALAAAAAAAAAAAGVSQAAVLGFLREHGGQVRNSELLSRFKPLLDAGDPRGRAARRDRFKQFVNNVAVVKELDGVKFVVLRKKPRPPEGPEAPLPSSPG 100

  Q2M3V2 -PGAAAQPSKPTSTVLP-RSASAPGAPPLVRVP-RPVEPPGDLGLPTEPQDTP----------GGPA-SEPAQPPGERSADPPLPALELAQATERPSADA 181
  Q8BLS7 VPAALAQ-----CAAVPAEDNCAPGAP---HSPQRSGEPPEDSSAPSELQHTPETLPSEVTQVEAPSGSAP-QPGG--PEDPALP---------R-SSEL 179

  Q2M3V2 APPPRAPSEAASPCSDPPDAEPGPGAAKGPPQQKPCMLPVRC-VPAPATLRLRAEEPGLRRQLSEEPSPRSSPLLLRRLSVEESGLGLGLGPGRSPHLRR 280
  Q8BLS7 ARPASVPSGLALTSTESPGPEPAPPTAQVPP-QKPCMLPVRCVVPGPAALRIRAEEQGLRRQRSEEPSPRGSPMLLRRLSVEESGLGLHLGPGRSPHLRR 278

  Q2M3V2 LSRAGPRLLSPDAEELPAAPPPS-AVPLEPSEHEWLVRTAGGRWTHQLHGLLLRDRGLAAKRDFMSGFTALHWAAKSGDGEMALQLVEVARRSGAPVDVN 379
  Q8BLS7 LSRAGPRLLSPDTEEMPVAPLPSPAVPLEPTEHEWLVRTASGRWSHQLHGLLLRDRGLAAKRDFMSGFTALHWAAKNGDREMALQLVEVARRGGAPVDVN 378

  Q2M3V2 ARSHGGYTPLHLAALHGHEDAAVLLVVRLGAQVHVRDHSGRRAYQYLRPGSSYALRRLLGDPGLRGTTEPDATGGGSGSLAARRPVQVAATILSSTTSAF 479
  Q8BLS7 ARSHGGYTPLHLAALHGHEDAAVLLVVRLGAQVHVRDYSGRRAYQYLRPGSSYALRRLLGDPGLRSMMEPDAASGGSGSLVSRHPVQVAATILSSTTSAF 478

  Q2M3V2 LGVLADDLMLQDLARGLKKSSSFSKFLSASPMAPRKKTKIRGGLPAFSEISRRPTPGPLAGLVPSFPPTT 549
  Q8BLS7 LGVLADDLMLQDLARGLKKSSSFSKFLGASPMAPRKKTKIRGGLPSFTEISHRSTPGPLAGLVPSLPPPT 548

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0031594 neuromuscular junction
1. PB GO:0044030 regulation of DNA methylation
1. PB GO:0036464 cytoplasmic ribonucleoprotein granule
1. PB GO:0007253 cytoplasmic sequestering of NF-kappaB
1. PB GO:0031436 BRCA1-BARD1 complex
2. P GO:0045611 negative regulation of hemocyte differentiation
2. P GO:0006954 inflammatory response
2. P GO:0003682 chromatin binding
2. P GO:0009953 dorsal/ventral pattern formation
2. P GO:0090309 positive regulation of DNA methylation-dependent heterochromatin assembly
2. P GO:0050729 positive regulation of inflammatory response
2. P GO:0045892 negative regulation of transcription, DNA-templated
2. P GO:2000321 positive regulation of T-helper 17 cell differentiation
2. P GO:0071212 subsynaptic reticulum
2. P GO:0007399 nervous system development
2. P GO:0009950 dorsal/ventral axis specification
2. P GO:0000786 nucleosome
2. P GO:0046843 dorsal appendage formation
2. P GO:0051059 NF-kappaB binding
2. P GO:0045597 positive regulation of cell differentiation
2. P GO:0000792 heterochromatin
2. P GO:0050852 T cell receptor signaling pathway
2. P GO:0045751 negative regulation of Toll signaling pathway
2. P GO:0005634 nucleus
2. P GO:0010468 regulation of gene expression
2. P GO:0045814 negative regulation of gene expression, epigenetic
2. P GO:0045869 negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
2. P GO:0016607 nuclear speck
2. P GO:0002789 negative regulation of antifungal peptide production
2. P GO:0048477 oogenesis
2. P GO:0035064 methylated histone binding
2. P GO:0019730 antimicrobial humoral response
2. P GO:2000812 regulation of barbed-end actin filament capping
3. B GO:1903356 positive regulation of distal tip cell migration
3. B GO:0071286 cellular response to magnesium ion
3. B GO:0043198 dendritic shaft
3. B GO:0050775 positive regulation of dendrite morphogenesis
3. B GO:0045111 intermediate filament cytoskeleton
3. B GO:0090037 positive regulation of protein kinase C signaling
3. B GO:0048709 oligodendrocyte differentiation
3. B GO:0043034 costamere
3. B GO:0032791 lead ion binding
3. B GO:0031297 replication fork processing
3. B GO:1903779 regulation of cardiac conduction
3. B GO:0016567 protein ubiquitination
3. B GO:0036166 phenotypic switching
3. B GO:0046469 platelet activating factor metabolic process
3. B GO:0001756 somitogenesis
3. B GO:0032421 stereocilium bundle
3. B GO:0039022 pronephric duct development
3. B GO:2001259 positive regulation of cation channel activity
3. B GO:0021514 ventral spinal cord interneuron differentiation
3. B GO:1903522 regulation of blood circulation
3. B GO:0045663 positive regulation of myoblast differentiation
3. B GO:0018105 peptidyl-serine phosphorylation
3. B GO:0019731 antibacterial humoral response
3. B GO:0014044 Schwann cell development
3. B GO:0006306 DNA methylation
3. B GO:0106310 protein serine kinase activity
3. B GO:0046974 histone methyltransferase activity (H3-K9 specific)
3. B GO:0098908 regulation of neuronal action potential
3. B GO:0018024 histone-lysine N-methyltransferase activity
3. B GO:0085020 protein K6-linked ubiquitination
3. B GO:0004842 ubiquitin-protein transferase activity
3. B GO:0047499 calcium-independent phospholipase A2 activity
3. B GO:0030018 Z disc
3. B GO:0048259 regulation of receptor-mediated endocytosis
3. B GO:0097431 mitotic spindle pole
3. B GO:0003950 NAD+ ADP-ribosyltransferase activity
3. B GO:0032956 regulation of actin cytoskeleton organization
3. B GO:0036372 opsin transport
3. B GO:0035264 multicellular organism growth
3. B GO:0021519 spinal cord association neuron specification
3. B GO:0021536 diencephalon development
3. B GO:0036377 arbuscular mycorrhizal association
3. B GO:0031116 positive regulation of microtubule polymerization
3. B GO:0046473 phosphatidic acid metabolic process
3. B GO:0045737 positive regulation of cyclin-dependent protein serine/threonine kinase activity
3. B GO:0099612 protein localization to axon
3. B GO:0045669 positive regulation of osteoblast differentiation
3. B GO:0005524 ATP binding
3. B GO:0034968 histone lysine methylation
3. B GO:0016571 histone methylation
3. B GO:0046338 phosphatidylethanolamine catabolic process
3. B GO:0101026 mitotic nuclear membrane biogenesis
3. B GO:0010765 positive regulation of sodium ion transport
3. B GO:0070588 calcium ion transmembrane transport
3. B GO:0035304 regulation of protein dephosphorylation
3. B GO:0018027 peptidyl-lysine dimethylation
3. B GO:0061551 trigeminal ganglion development
3. B GO:0035690
3. B GO:0010960 magnesium ion homeostasis
3. B GO:0008542 visual learning
3. B GO:0072659 protein localization to plasma membrane
3. B GO:0086015 SA node cell action potential
3. B GO:0015267 channel activity
3. B GO:0102568
3. B GO:1990404 protein ADP-ribosylase activity
3. B GO:0042325 regulation of phosphorylation
3. B GO:0016328 lateral plasma membrane
3. B GO:0007520 myoblast fusion
3. B GO:0003151 outflow tract morphogenesis
3. B GO:0021675 nerve development
3. B GO:0002039 p53 binding
3. B GO:0000281 mitotic cytokinesis
3. B GO:0001841 neural tube formation
3. B GO:0048899 anterior lateral line development
3. B GO:0001222 transcription corepressor binding
3. B GO:0007009 plasma membrane organization
3. B GO:0043292 contractile fiber
3. B GO:0070417 cellular response to cold
3. B GO:0010564 regulation of cell cycle process
3. B GO:0070212 protein poly-ADP-ribosylation
3. B GO:1904058 positive regulation of sensory perception of pain
3. B GO:0018026 peptidyl-lysine monomethylation
3. B GO:0007160 cell-matrix adhesion
3. B GO:0032426 stereocilium tip
3. B GO:0043409 negative regulation of MAPK cascade
3. B GO:0043008 ATP-dependent protein binding
3. B GO:0019228 neuronal action potential
3. B GO:0005654 nucleoplasm
3. B GO:0021555 midbrain-hindbrain boundary morphogenesis
3. B GO:0086046 membrane depolarization during SA node cell action potential
3. B GO:0051569 regulation of histone H3-K4 methylation
3. B GO:0004622 lysophospholipase activity
3. B GO:0007005 mitochondrion organization
3. B GO:0072357 PTW/PP1 phosphatase complex
3. B GO:0009925 basal plasma membrane
3. B GO:0009932 cell tip growth
3. B GO:0043086 negative regulation of catalytic activity
3. B GO:0022011 myelination in peripheral nervous system
3. B GO:0010650 positive regulation of cell communication by electrical coupling
3. B GO:0010313 phytochrome binding
3. B GO:0097546 ciliary base
3. B GO:0000209 protein polyubiquitination
3. B GO:0001947 heart looping
3. B GO:0090201 negative regulation of release of cytochrome c from mitochondria
3. B GO:0002027 regulation of heart rate
3. B GO:0010638 positive regulation of organelle organization
3. B GO:0005178 integrin binding
3. B GO:2000178 negative regulation of neural precursor cell proliferation
3. B GO:0044325 transmembrane transporter binding
3. B GO:0008593 regulation of Notch signaling pathway
3. B GO:0006897 endocytosis
3. B GO:0070650 actin filament bundle distribution
3. B GO:0098904 regulation of AV node cell action potential
3. B GO:0072116 pronephros formation
3. B GO:1901339 regulation of store-operated calcium channel activity
3. B GO:0006887 exocytosis
3. B GO:0071314 cellular response to cocaine
3. B GO:0000242 pericentriolar material
3. B GO:1990760 osmolarity-sensing cation channel activity
3. B GO:0045787 positive regulation of cell cycle
3. B GO:0046875 ephrin receptor binding
3. B GO:0010366 negative regulation of ethylene biosynthetic process
3. B GO:0046826 negative regulation of protein export from nucleus
3. B GO:1900246 positive regulation of RIG-I signaling pathway
3. B GO:1904901 positive regulation of myosin II filament organization
3. B GO:0098907 regulation of SA node cell action potential
3. B GO:0003408 optic cup formation involved in camera-type eye development
3. B GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
3. B GO:0035965 cardiolipin acyl-chain remodeling
3. B GO:0001568 blood vessel development
3. B GO:0030155 regulation of cell adhesion
3. B GO:0086014 atrial cardiac muscle cell action potential
3. B GO:0016409 palmitoyltransferase activity
3. B GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus
3. B GO:0051289 protein homotetramerization
3. B GO:0046957 negative phototaxis
3. B GO:0097604 temperature-gated cation channel activity
3. B GO:0070213 protein auto-ADP-ribosylation
3. B GO:0004672 protein kinase activity
3. B GO:0051973 positive regulation of telomerase activity
3. B GO:0030507 spectrin binding
3. B GO:0043518 negative regulation of DNA damage response, signal transduction by p53 class mediator
3. B GO:0010923 negative regulation of phosphatase activity
3. B GO:0099523 presynaptic cytosol
3. B GO:0048812 neuron projection morphogenesis
3. B GO:0033292 T-tubule organization
3. B GO:1904908 negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric
3. B GO:0051117 ATPase binding
3. B GO:0070682 proteasome regulatory particle assembly
3. B GO:1900245 positive regulation of MDA-5 signaling pathway
3. B GO:0031143 pseudopodium
3. B GO:0051017 actin filament bundle assembly
3. B GO:1900087 positive regulation of G1/S transition of mitotic cell cycle
3. B GO:0048148 behavioral response to cocaine
3. B GO:0071244 cellular response to carbon dioxide
3. B GO:0009566 fertilization
3. B GO:0106311
3. B GO:0014832 urinary bladder smooth muscle contraction
3. B GO:0071889 14-3-3 protein binding
3. B GO:0014069 postsynaptic density
3. B GO:0043406 positive regulation of MAP kinase activity
3. B GO:0001954 positive regulation of cell-matrix adhesion
3. B GO:0051726 regulation of cell cycle
3. B GO:0035844 cloaca development
3. B GO:0014912 negative regulation of smooth muscle cell migration
3. B GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0006469 negative regulation of protein kinase activity
3. B GO:1904855 proteasome regulatory particle binding
3. B GO:0030307 positive regulation of cell growth
3. B GO:0099092 postsynaptic density, intracellular component
3. B GO:0045211 postsynaptic membrane
3. B GO:0014070 response to organic cyclic compound
3. B GO:1902412 regulation of mitotic cytokinesis
3. B GO:0043266 regulation of potassium ion transport
3. B GO:0050955 thermoception
3. B GO:0030017 sarcomere
3. B GO:1902902 negative regulation of autophagosome assembly
3. B GO:0043491 protein kinase B signaling
3. B GO:0050772 positive regulation of axonogenesis
3. B GO:0016055 Wnt signaling pathway
3. B GO:2000651 positive regulation of sodium ion transmembrane transporter activity
3. B GO:0051967 negative regulation of synaptic transmission, glutamatergic
3. B GO:0007080 mitotic metaphase plate congression
3. B GO:0048815 hermaphrodite genitalia morphogenesis
3. B GO:0061195 taste bud formation
3. B GO:0031398 positive regulation of protein ubiquitination
3. B GO:0018345 protein palmitoylation
3. B GO:0032288 myelin assembly
3. B GO:0140031 phosphorylation-dependent protein binding
3. B GO:0001934 positive regulation of protein phosphorylation
3. B GO:0086091 regulation of heart rate by cardiac conduction
3. B GO:1900140 regulation of seedling development
3. B GO:0048705 skeletal system morphogenesis
3. B GO:2000304 positive regulation of ceramide biosynthetic process
3. B GO:0031670 cellular response to nutrient
3. B GO:0019208 phosphatase regulator activity
3. B GO:0030315 T-tubule
3. B GO:0055117 regulation of cardiac muscle contraction
3. B GO:0034451 centriolar satellite
3. B GO:0007409 axonogenesis
3. B GO:0090263 positive regulation of canonical Wnt signaling pathway
3. B GO:0000502 proteasome complex
3. B GO:1902260 negative regulation of delayed rectifier potassium channel activity
3. B GO:0031013 troponin I binding
3. B GO:0031430 M band
3. B GO:0045995 regulation of embryonic development
3. B GO:0070198 protein localization to chromosome, telomeric region
3. B GO:0090238 positive regulation of arachidonic acid secretion
3. B GO:0005262 calcium channel activity
3. B GO:0010761 fibroblast migration
3. B GO:0017020 myosin phosphatase regulator activity
3. B GO:0102545 phosphatidyl phospholipase B activity
3. B GO:0097062 dendritic spine maintenance
3. B GO:0031672 A band
3. B GO:0045838 positive regulation of membrane potential
3. B GO:0005929 cilium
3. B GO:0098910 regulation of atrial cardiac muscle cell action potential
3. B GO:0036371 protein localization to T-tubule
3. B GO:0043194 axon initial segment
3. B GO:0048662 negative regulation of smooth muscle cell proliferation
3. B GO:0099527 postsynapse to nucleus signaling pathway
3. B GO:0033309 SBF transcription complex
3. B GO:0070742 C2H2 zinc finger domain binding
3. B GO:0048265 response to pain
3. B GO:0016279 protein-lysine N-methyltransferase activity
3. B GO:0043066 negative regulation of apoptotic process
3. B GO:0007613 memory
3. B GO:0007165 signal transduction
3. B GO:0010424 DNA methylation on cytosine within a CG sequence
3. B GO:1904355 positive regulation of telomere capping
3. B GO:0014731 spectrin-associated cytoskeleton
3. B GO:0033270 paranode region of axon
3. B GO:0005737 cytoplasm
3. B GO:0098978 glutamatergic synapse
3. B GO:0072114 pronephros morphogenesis
3. B GO:0045184 establishment of protein localization
3. B GO:0017124 SH3 domain binding
3. B GO:0003847 1-alkyl-2-acetylglycerophosphocholine esterase activity
3. B GO:0010882 regulation of cardiac muscle contraction by calcium ion signaling
3. B GO:0016323 basolateral plasma membrane
3. B GO:2001257 regulation of cation channel activity
3. B GO:0098871 postsynaptic actin cytoskeleton
3. B GO:0097435 supramolecular fiber organization
3. B GO:0046822 regulation of nucleocytoplasmic transport
3. B GO:0097120 receptor localization to synapse
3. B GO:0014704 intercalated disc
3. B GO:0007098 centrosome cycle
3. B GO:0019901 protein kinase binding
3. B GO:0001955 blood vessel maturation
3. B GO:0030907 MBF transcription complex
3. B GO:0007219 Notch signaling pathway
3. B GO:0010288 response to lead ion
3. B GO:0001658 branching involved in ureteric bud morphogenesis
3. B GO:0017171 serine hydrolase activity
3. B GO:0009610 response to symbiotic fungus
3. B GO:0035265 organ growth
3. B GO:0010881 regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
3. B GO:0031441 negative regulation of mRNA 3'-end processing
3. B GO:0034638 phosphatidylcholine catabolic process
3. B GO:0042383 sarcolemma
3. B GO:0021546 rhombomere development
3. B GO:0030030 cell projection organization
3. B GO:0050931 pigment cell differentiation
3. B GO:0043001 Golgi to plasma membrane protein transport
3. B GO:0046976 histone methyltransferase activity (H3-K27 specific)
3. B GO:0032212 positive regulation of telomere maintenance via telomerase
3. B GO:0050960 detection of temperature stimulus involved in thermoception
3. B GO:0007569 cell aging
3. B GO:0002040 sprouting angiogenesis
3. B GO:0007130 synaptonemal complex assembly
3. B GO:0005856 cytoskeleton
3. B GO:0001894 tissue homeostasis
3. B GO:0060236 regulation of mitotic spindle organization
3. B GO:0043195 terminal bouton
3. B GO:0016529 sarcoplasmic reticulum
3. B GO:0060325 face morphogenesis
3. B GO:0051225 spindle assembly
3. B GO:0099175 regulation of postsynapse organization
3. B GO:0050968 detection of chemical stimulus involved in sensory perception of pain
3. B GO:0007229 integrin-mediated signaling pathway
3. B GO:0030034 microvillar actin bundle assembly
3. B GO:1904743 negative regulation of telomeric DNA binding
3. B GO:1900383 regulation of synaptic plasticity by receptor localization to synapse
3. B GO:0072660 maintenance of protein location in plasma membrane
3. B GO:0090314 positive regulation of protein targeting to membrane
3. B GO:0009967 positive regulation of signal transduction
3. B GO:0086004 regulation of cardiac muscle cell contraction
3. B GO:0048013 ephrin receptor signaling pathway
3. B GO:1901019 regulation of calcium ion transmembrane transporter activity
3. B GO:0009409 response to cold
3. B GO:0043197 dendritic spine
3. B GO:0102991 myristoyl-CoA hydrolase activity
3. B GO:0045162 clustering of voltage-gated sodium channels
3. B GO:0010378 temperature compensation of the circadian clock
3. B GO:0019233 sensory perception of pain
3. B GO:0045197 establishment or maintenance of epithelial cell apical/basal polarity
3. B GO:0048920 posterior lateral line neuromast primordium migration
3. B GO:0033209 tumor necrosis factor-mediated signaling pathway
3. B GO:0030027 lamellipodium
3. B GO:0043065 positive regulation of apoptotic process
3. B GO:0036309 protein localization to M-band
3. B GO:0033268 node of Ranvier
3. B GO:0048665 neuron fate specification
3. B GO:0010171 body morphogenesis
3. B GO:0090200 positive regulation of release of cytochrome c from mitochondria
3. B GO:0043596 nuclear replication fork
3. B GO:0035507 regulation of myosin-light-chain-phosphatase activity
3. B GO:0034394 protein localization to cell surface
3. B GO:0008092 cytoskeletal protein binding
3. B GO:0071709 membrane assembly
3. B GO:0086069 bundle of His cell to Purkinje myocyte communication
3. B GO:0034446 substrate adhesion-dependent cell spreading
3. B GO:0015278 calcium-release channel activity
3. B GO:0051924 regulation of calcium ion transport
3. B GO:0045921 positive regulation of exocytosis
3. B GO:0042311 vasodilation
3. B GO:0085042 periarbuscular membrane
3. B GO:0060992 response to fungicide
3. B GO:0016290 palmitoyl-CoA hydrolase activity
3. B GO:0030673 axolemma
3. B GO:0051928 positive regulation of calcium ion transport
3. B GO:0034112 positive regulation of homotypic cell-cell adhesion
3. B GO:0021508 floor plate formation
3. B GO:0043679 axon terminus
3. B GO:0051570 regulation of histone H3-K9 methylation
3. B GO:0010033 response to organic substance
3. B GO:0006471 protein ADP-ribosylation
3. B GO:0070531 BRCA1-A complex
3. B GO:0004857 enzyme inhibitor activity
3. B GO:0086070 SA node cell to atrial cardiac muscle cell communication
3. B GO:0005200 structural constituent of cytoskeleton
3. B GO:1901018 positive regulation of potassium ion transmembrane transporter activity
3. B GO:0048859 formation of anatomical boundary
3. B GO:0060135 maternal process involved in female pregnancy
3. B GO:0042327 positive regulation of phosphorylation
3. B GO:0070972 protein localization to endoplasmic reticulum
3. B GO:0043268 positive regulation of potassium ion transport
3. B GO:0086066 atrial cardiac muscle cell to AV node cell communication
3. B GO:1901021 positive regulation of calcium ion transmembrane transporter activity
3. B GO:1901224 positive regulation of NIK/NF-kappaB signaling
3. B GO:0016021 integral component of membrane
3. B GO:0060035 notochord cell development
3. B GO:0005925 focal adhesion
3. B GO:0021654 rhombomere boundary formation
3. B GO:0045685 regulation of glial cell differentiation
3. B GO:0050966 detection of mechanical stimulus involved in sensory perception of pain
3. B GO:0030513 positive regulation of BMP signaling pathway
3. B GO:0051151 negative regulation of smooth muscle cell differentiation
3. B GO:2001279 regulation of unsaturated fatty acid biosynthetic process
3. B GO:0046872 metal ion binding
3. B GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity
3. B GO:0042281 dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase activity
3. B GO:0055002 striated muscle cell development
3. B GO:0097553 calcium ion transmembrane import into cytosol
3. B GO:0035508 positive regulation of myosin-light-chain-phosphatase activity
3. B GO:0007528 neuromuscular junction development
3. B GO:0000062 fatty-acyl-CoA binding
3. B GO:1900827 positive regulation of membrane depolarization during cardiac muscle cell action potential
3. B GO:0048892 lateral line nerve development
3. B GO:0032049 cardiolipin biosynthetic process
3. B GO:0045807 positive regulation of endocytosis
3. B GO:0098686 hippocampal mossy fiber to CA3 synapse
3. B GO:0042326 negative regulation of phosphorylation
3. B GO:0008093 cytoskeletal anchor activity
3. B GO:0010667 negative regulation of cardiac muscle cell apoptotic process
3. B GO:0102567
3. B GO:0019706 protein-cysteine S-palmitoyltransferase activity
3. B GO:0048916 posterior lateral line development
3. B GO:1903793 positive regulation of anion transport
3. B GO:0021521 ventral spinal cord interneuron specification
3. B GO:0005938 cell cortex
3. B GO:0045773 positive regulation of axon extension
3. B GO:1904357 negative regulation of telomere maintenance via telomere lengthening
3. B GO:0032088 negative regulation of NF-kappaB transcription factor activity
3. B GO:0030674 protein-macromolecule adaptor activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8BZW2 Ankyrin repeat domain-containing protein SOWAHB 5.99e-02 1.20e-10 3.67e-34
1. PB A6NEL2 Ankyrin repeat domain-containing protein SOWAHB 1.60e-02 1.78e-11 4.39e-34
1. PB Q8BLS7 Ankyrin repeat domain-containing protein SOWAHA 1.89e-08 1.51e-99 0.0
1. PB Q6NRK3 Ankyrin repeat domain-containing protein SOWAHB 3.66e-02 8.86e-13 1.56e-37
1. PB Q53LP3 Ankyrin repeat domain-containing protein SOWAHC 6.60e-04 7.37e-35 4.59e-31
1. PB Q8C0J6 Ankyrin repeat domain-containing protein SOWAHC 1.48e-04 8.61e-40 1.89e-06
1. PB Q2M3V2 Ankyrin repeat domain-containing protein SOWAHA 0 5.52e-164 0.0
2. P Q21209 BRCA1-associated RING domain protein 1 3.58e-02 1.58e-02 NA
2. P P83757 NF-kappa-B inhibitor cactus NA 2.26e-04 NA
2. P G3V8T1 M-phase phosphoprotein 8 3.19e-02 4.35e-08 NA
2. P G5EDE9 ANK repeat-containing protein nipk-1 2.03e-01 4.39e-06 NA
2. P Q99549 M-phase phosphoprotein 8 1.92e-02 3.23e-07 NA
2. P Q9BE45 NF-kappa-B inhibitor zeta 1.09e-02 1.77e-02 NA
2. P Q03017 NF-kappa-B inhibitor cactus 1.17e-02 2.65e-05 NA
2. P Q9BYH8 NF-kappa-B inhibitor zeta 9.30e-02 1.73e-03 NA
2. P Q4KL97 Ankyrin repeat domain-containing protein 1 1.57e-02 9.95e-04 NA
2. P Q3TYA6 M-phase phosphoprotein 8 3.60e-02 2.81e-08 NA
2. P Q9EST8 NF-kappa-B inhibitor zeta 1.35e-02 3.89e-02 NA
2. P Q05753 Ankyrin repeat domain-containing protein, chloroplastic 2.10e-02 3.66e-02 NA
3. B Q9BGT9 Ankyrin repeat and SOCS box protein 7 1.06e-04 NA 8.26e-07
3. B Q9C0D5 Protein TANC1 6.61e-01 NA 0.006
3. B Q8N9V6 Ankyrin repeat domain-containing protein 53 1.32e-02 NA 2.83e-04
3. B Q00PJ1 Cortactin-binding protein 2 2.09e-01 NA 5.90e-05
3. B Q9Z1P7 KN motif and ankyrin repeat domain-containing protein 3 1.47e-02 NA 4.68e-04
3. B O70445 BRCA1-associated RING domain protein 1 2.84e-02 NA 0.041
3. B Q92527 Ankyrin repeat domain-containing protein 7 3.60e-05 NA 6.86e-04
3. B Q25338 Delta-latroinsectotoxin-Lt1a 1.93e-01 NA 0.006
3. B Q80SY4 E3 ubiquitin-protein ligase MIB1 5.14e-02 NA 0.023
3. B Q0V8G2 GA-binding protein subunit beta-2 1.33e-02 NA 0.020
3. B Q02989 Alpha-latroinsectotoxin-Lt1a (Fragment) 2.92e-01 NA 0.011
3. B P16157 Ankyrin-1 7.90e-01 NA 0.006
3. B O14974 Protein phosphatase 1 regulatory subunit 12A 4.49e-01 NA 7.38e-04
3. B Q99NH0 Ankyrin repeat domain-containing protein 17 5.57e-01 NA 0.009
3. B Q337A0 Probable E3 ubiquitin-protein ligase XBOS33 4.27e-02 NA 0.035
3. B Q86YT6 E3 ubiquitin-protein ligase MIB1 3.03e-01 NA 0.027
3. B Q0VGY8 Protein TANC1 5.15e-01 NA 0.003
3. B B2RXR6 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B 4.99e-02 NA 0.002
3. B Q502K3 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 3.21e-02 NA 0.011
3. B O95271 Poly [ADP-ribose] polymerase tankyrase-1 5.25e-02 NA 0.014
3. B Q9TZC4 Integrin-linked protein kinase homolog pat-4 1.63e-02 NA 0.011
3. B Q66H07 Fibronectin type 3 and ankyrin repeat domains 1 protein 1.94e-02 NA 0.003
3. B A9JR78 Tonsoku-like protein 5.35e-01 NA 0.031
3. B Q53RE8 Ankyrin repeat domain-containing protein 39 5.64e-04 NA 9.23e-05
3. B Q9EP71 Ankycorbin 4.83e-02 NA 0.005
3. B D3J162 Protein VAPYRIN 1.05e-01 NA 6.11e-06
3. B Q0P5B9 Ankyrin repeat domain-containing protein 39 1.91e-04 NA 7.09e-05
3. B Q2QLB3 Cortactin-binding protein 2 1.30e-01 NA 0.005
3. B Q06527 Ankyrin homolog 1.15e-04 NA 0.014
3. B Q6UB99 Ankyrin repeat domain-containing protein 11 7.25e-01 NA 0.031
3. B Q6PFX9 Poly [ADP-ribose] polymerase tankyrase-1 1.22e-01 NA 0.016
3. B O55222 Integrin-linked protein kinase 1.49e-02 NA 0.003
3. B Q2IBB2 Cortactin-binding protein 2 1.15e-01 NA 0.003
3. B Q5ZLC6 Ankyrin repeat domain-containing protein 10 6.97e-03 NA 0.001
3. B C7B178 Protein VAPYRIN 1.25e-02 NA 6.19e-07
3. B Q07E41 Cortactin-binding protein 2 2.25e-01 NA 5.99e-04
3. B Q2QLG9 Cortactin-binding protein 2 2.10e-01 NA 7.50e-05
3. B Q9Z2X2 26S proteasome non-ATPase regulatory subunit 10 2.70e-05 NA 1.92e-05
3. B Q09YI1 Cortactin-binding protein 2 2.84e-01 NA 3.67e-04
3. B P97819 85/88 kDa calcium-independent phospholipase A2 5.59e-02 NA 0.032
3. B Q7Z020 Transient receptor potential cation channel subfamily A member 1 4.65e-01 NA 0.034
3. B Q8VHK2 Caskin-1 6.50e-01 NA 0.039
3. B Q8N6D5 Ankyrin repeat domain-containing protein 29 4.03e-04 NA 0.023
3. B Q9P0K7 Ankycorbin 3.45e-02 NA 0.004
3. B O15084 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A 1.03e-01 NA 1.55e-04
3. B O13987 Ankyrin and IPT/TIG repeat-containing protein C26H5.05 1.57e-01 NA 0.013
3. B Q60772 Cyclin-dependent kinase 4 inhibitor C 4.93e-05 NA 0.009
3. B Q96AX9 E3 ubiquitin-protein ligase MIB2 9.83e-02 NA 0.022
3. B Q02357 Ankyrin-1 9.55e-01 NA 0.005
3. B A0A3L7I2I8 85/88 kDa calcium-independent phospholipase A2 1.03e-01 NA 0.012
3. B Q8BTI7 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 1.72e-01 NA 0.005
3. B Q06852 Cell surface glycoprotein 1 8.43e-01 NA 0.008
3. B Q923M0 Protein phosphatase 1 regulatory subunit 16A 1.09e-02 NA 0.004
3. B Q8N8A2 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B 4.98e-02 NA 0.004
3. B Q59H18 Serine/threonine-protein kinase TNNI3K 7.18e-03 NA 9.86e-05
3. B Q9SM23 Acyl-CoA-binding domain-containing protein 1 6.89e-03 NA 0.005
3. B Q5F478 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B 5.20e-02 NA 0.005
3. B Q9H9B1 Histone-lysine N-methyltransferase EHMT1 1.12e-01 NA 2.55e-04
3. B Q7TQP6 Serine/threonine-protein kinase TNNI3K 4.32e-02 NA 8.37e-04
3. B Q07E28 Cortactin-binding protein 2 5.32e-01 NA 0.001
3. B P0CS67 Palmitoyltransferase AKR1 2.16e-01 NA 0.014
3. B P42773 Cyclin-dependent kinase 4 inhibitor C 6.10e-06 NA 0.023
3. B Q8BY98 Ankyrin repeat domain-containing protein SOWAHD 4.60e-04 NA 2.89e-22
3. B Q554E7 Putative ZDHHC-type palmitoyltransferase 5 3.57e-02 NA 0.028
3. B Q4JHE0 Probable E3 ubiquitin-protein ligase XBOS36 6.43e-03 NA 7.11e-04
3. B G5E8K5 Ankyrin-3 9.83e-01 NA 1.83e-04
3. B Q5GIG6 Serine/threonine-protein kinase TNNI3K 3.63e-02 NA 0.001
3. B Q9VUX2 E3 ubiquitin-protein ligase mind-bomb 3.54e-01 NA 0.002
3. B A0M8T5 Cortactin-binding protein 2 2.22e-01 NA 5.13e-04
3. B Q9DAM9 Fibronectin type 3 and ankyrin repeat domains 1 protein 6.58e-03 NA 0.003
3. B Q7T0Q1 Myotrophin 1.33e-06 NA 0.049
3. B Q07E15 Cortactin-binding protein 2 4.47e-01 NA 4.02e-05
3. B Q6P6B7 Ankyrin repeat domain-containing protein 16 5.39e-04 NA 0.029
3. B O60733 85/88 kDa calcium-independent phospholipase A2 6.04e-02 NA 0.036
3. B Q9V7A7 G patch domain and ankyrin repeat-containing protein 1 homolog 1.23e-01 NA 0.015
3. B O70511 Ankyrin-3 9.52e-01 NA 3.70e-05
3. B Q90623 Protein phosphatase 1 regulatory subunit 12A 3.77e-01 NA 5.26e-04
3. B Q09YJ3 Cortactin-binding protein 2 1.54e-01 NA 3.43e-04
3. B Q12955 Ankyrin-3 NA NA 5.10e-05
3. B Q8Q0U0 Putative ankyrin repeat protein MM_0045 2.03e-04 NA 4.78e-04
3. B Q9Z2X3 26S proteasome non-ATPase regulatory subunit 10 2.74e-05 NA 2.88e-07
3. B Q7EZ44 Probable E3 ubiquitin-protein ligase XBOS35 3.51e-02 NA 3.52e-04
3. B Q755Y0 Palmitoyltransferase AKR1 7.47e-02 NA 0.010
3. B Q6RI86 Transient receptor potential cation channel subfamily A member 1 8.29e-02 NA 0.002
3. B Q10728 Protein phosphatase 1 regulatory subunit 12A 3.16e-01 NA 6.28e-04
3. B Q1RMI3 GA-binding protein subunit beta-1 8.84e-03 NA 0.005
3. B Q3V0J4 Ankyrin repeat domain-containing protein 53 1.24e-02 NA 6.90e-05
3. B Q7Z6G8 Ankyrin repeat and sterile alpha motif domain-containing protein 1B 6.17e-01 NA 0.003
3. B Q07DV1 Cortactin-binding protein 2 2.06e-01 NA 5.63e-04
3. B D3J163 Protein VAPYRIN-LIKE 4.41e-02 NA 1.46e-04
3. B Q5R5V4 Integrin-linked protein kinase 2.91e-03 NA 0.003
3. B O75762 Transient receptor potential cation channel subfamily A member 1 2.59e-02 NA 0.003
3. B O75832 26S proteasome non-ATPase regulatory subunit 10 1.24e-05 NA 6.83e-05
3. B Q9STP8 Acyl-CoA-binding domain-containing protein 2 4.46e-02 NA 0.006
3. B Q07DW4 Cortactin-binding protein 2 2.93e-01 NA 0.001
3. B Q6KAE5 Probable E3 ubiquitin-protein ligase XBOS32 2.55e-02 NA 0.049
3. B Q4R3S3 Ankyrin repeat domain-containing protein 7 5.90e-05 NA 0.002
3. B Q07DX4 Cortactin-binding protein 2 1.50e-01 NA 2.44e-04
3. B Q38898 Potassium channel AKT2/3 5.92e-02 NA 0.009
3. B A0M8S4 Cortactin-binding protein 2 5.26e-01 NA 0.003
3. B Q8BLA8 Transient receptor potential cation channel subfamily A member 1 1.15e-01 NA 0.002
3. B G4SLH0 Titin homolog NA NA 0.003
3. B Q09YK4 Cortactin-binding protein 2 1.40e-01 NA 3.02e-04
3. B Q8C8R3 Ankyrin-2 NA NA 4.77e-06
3. B Q6F6B3 Protein TANC1 8.71e-01 NA 0.003
3. B E9Q4F7 Ankyrin repeat domain-containing protein 11 8.00e-01 NA 0.030
3. B Q7T3X9 Notch-regulated ankyrin repeat-containing protein B 2.10e-03 NA 0.038
3. B Q2QLA2 Cortactin-binding protein 2 2.50e-01 NA 0.001
3. B Q5RF15 Serine/threonine-protein kinase TNNI3K 1.25e-03 NA 0.001
3. B O75179 Ankyrin repeat domain-containing protein 17 4.13e-01 NA 0.010
3. B Q9UU77 Ankyrin repeat-containing protein P1E11.10 1.62e-04 NA 0.012
3. B Q8BIZ1 Ankyrin repeat and sterile alpha motif domain-containing protein 1B 4.48e-01 NA 0.002
3. B Q09YM8 Cortactin-binding protein 2 4.42e-01 NA 8.79e-04
3. B Q9QZH2 BRCA1-associated RING domain protein 1 1.59e-02 NA 0.024
3. B Q8TC84 Fibronectin type 3 and ankyrin repeat domains protein 1 2.13e-02 NA 4.24e-04
3. B Q6P9K8 Caskin-1 6.40e-01 NA 0.031
3. B Q9D119 Protein phosphatase 1 regulatory subunit 27 1.56e-05 NA 0.017
3. B Q99728 BRCA1-associated RING domain protein 1 4.75e-02 NA 0.023
3. B Q9H2K2 Poly [ADP-ribose] polymerase tankyrase-2 2.47e-01 NA 0.027
3. B Q2IBA2 Cortactin-binding protein 2 4.20e-01 NA 0.002
3. B P97570 85/88 kDa calcium-independent phospholipase A2 7.60e-02 NA 0.035
3. B A3AYR1 Acyl-CoA-binding domain-containing protein 4 3.14e-02 NA 0.001
3. B Q5DW34 Histone-lysine N-methyltransferase EHMT1 7.64e-02 NA 0.002
3. B Q07DY4 Cortactin-binding protein 2 3.11e-01 NA 0.002
3. B Q3SWY2 Integrin-linked protein kinase 1.15e-02 NA 0.003
3. B Q06547 GA-binding protein subunit beta-1 1.83e-02 NA 0.004
3. B A5PMU4 Ankyrin repeat and sterile alpha motif domain-containing protein 1B 3.36e-01 NA 0.026
3. B A1X157 Cortactin-binding protein 2 3.57e-01 NA 0.001
3. B Q9Z148 Histone-lysine N-methyltransferase EHMT2 1.95e-01 NA 8.55e-06
3. B Q9CZK6 Ankyrin repeat and SAM domain-containing protein 3 2.75e-02 NA 0.016
3. B P0DJE3 Alpha-latrotoxin-Lhe1a 3.38e-01 NA 0.038
3. B Q5RCK5 Ankyrin repeat and SOCS box protein 7 7.84e-05 NA 7.48e-07
3. B Q96KQ7 Histone-lysine N-methyltransferase EHMT2 7.89e-02 NA 4.36e-05
3. B Q2QLF8 Cortactin-binding protein 2 5.91e-01 NA 1.87e-04
3. B Q2IBF7 Cortactin-binding protein 2 2.57e-01 NA 3.59e-04
3. B Q99J82 Integrin-linked protein kinase 5.76e-03 NA 0.003
3. B Q8UVC1 Inversin 3.11e-01 NA 0.012
3. B Q99LW0 Ankyrin repeat domain-containing protein 10 1.11e-02 NA 6.99e-04
3. B Q91ZU0 Ankyrin repeat and SOCS box protein 7 1.06e-04 NA 7.89e-07
3. B Q9VSA4 Tonsoku-like protein 5.11e-01 NA 0.004
3. B Q6GNY1 E3 ubiquitin-protein ligase mib1 1.31e-01 NA 0.037
3. B Q3UYR4 Espin-like protein 6.26e-02 NA 4.89e-05
3. B Q4UMH6 Putative ankyrin repeat protein RF_0381 2.05e-01 NA 2.24e-05
3. B Q804S5 E3 ubiquitin-protein ligase mib1 2.05e-01 NA 0.016
3. B Q3UES3 Poly [ADP-ribose] polymerase tankyrase-2 1.15e-01 NA 0.029
3. B A6NJG2 Ankyrin repeat domain-containing protein SOWAHD 4.34e-05 NA 5.33e-22
3. B P0CS66 Palmitoyltransferase AKR1 1.64e-01 NA 0.014
3. B Q2IBF8 Cortactin-binding protein 2 1.88e-01 NA 2.04e-04
3. B Q8NB46 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 7.61e-02 NA 0.004
3. B Q9L7Q2 Zinc metalloprotease ZmpB 8.83e-01 NA 0.006
3. B Q108T9 Cortactin-binding protein 2 3.53e-01 NA 8.53e-05
3. B Q9H672 Ankyrin repeat and SOCS box protein 7 1.00e-04 NA 8.18e-07
3. B B1AK53 Espin 4.07e-01 NA 0.006
3. B Q5ZIJ9 E3 ubiquitin-protein ligase MIB2 1.46e-01 NA 1.80e-04
3. B Q8BZ25 Ankyrin repeat and protein kinase domain-containing protein 1 1.73e-02 NA 3.10e-04
3. B Q8UVC3 Inversin 2.58e-01 NA 0.005
3. B Q2IBE6 Cortactin-binding protein 2 3.06e-01 NA 3.29e-04
3. B P57044 Integrin-linked protein kinase 4.14e-03 NA 0.003
3. B P50086 Probable 26S proteasome regulatory subunit p28 9.59e-06 NA 0.005
3. B Q09YG9 Cortactin-binding protein 2 2.68e-01 NA 8.94e-04
3. B Q8BG95 Protein phosphatase 1 regulatory subunit 12B 5.15e-01 NA 0.026
3. B Q75HA6 BTB/POZ domain and ankyrin repeat-containing protein NPR3 5.64e-02 NA 0.025
3. B Q13418 Integrin-linked protein kinase 1.19e-02 NA 0.003
3. B Q9BXW6 Oxysterol-binding protein-related protein 1 1.34e-02 NA 0.002
3. B Q52T38 Protein S-acyltransferase 24 1.26e-02 NA 0.014
3. B Q8WXD9 Caskin-1 9.56e-01 NA 0.030
3. B P46683 Ankyrin repeat-containing protein YAR1 6.34e-04 NA 0.049
3. B P0C6S7 Ankyrin repeat and sterile alpha motif domain-containing protein 1B 3.13e-01 NA 0.003
3. B Q5ZLC8 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 1.35e-01 NA 0.001
3. B Q505D1 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A 1.54e-01 NA 1.85e-04
3. B O90760 Putative ankyrin repeat protein FPV031 NA NA 2.20e-04
3. B Q01484 Ankyrin-2 NA NA 8.39e-06
3. B Q8WZ74 Cortactin-binding protein 2 1.57e-01 NA 3.24e-04
3. B P81069 GA-binding protein subunit beta-2 1.15e-02 NA 0.032
3. B Q9DF58 Integrin-linked protein kinase 1.25e-02 NA 8.33e-04
3. B Q9NXR5 Ankyrin repeat domain-containing protein 10 9.32e-03 NA 7.49e-04
3. B Q8NFD2 Ankyrin repeat and protein kinase domain-containing protein 1 3.18e-02 NA 0.003
3. B Q00420 GA-binding protein subunit beta-1 4.91e-03 NA 0.003
3. B Q6NLQ8 E3 ubiquitin-protein ligase XBAT32 1.60e-02 NA 1.39e-04
3. B Q6DRG7 Protein phosphatase 1 regulatory subunit 12A 7.32e-01 NA 2.29e-04
3. B Q9DBR7 Protein phosphatase 1 regulatory subunit 12A 5.71e-01 NA 6.89e-04
3. B Q4R739 Ankyrin repeat domain-containing protein 53 6.73e-02 NA 0.006
3. B Q86WC6 Protein phosphatase 1 regulatory subunit 27 1.86e-05 NA 0.012
3. B Q9VBP3 Poly [ADP-ribose] polymerase tankyrase 2.28e-01 NA 0.036
3. B Q2QL82 Cortactin-binding protein 2 1.81e-01 NA 1.50e-04
3. B Q6ZVH7 Espin-like protein 4.47e-02 NA 8.07e-04
3. B Q9FF09 Phytochrome-interacting ankyrin-repeat protein 1 3.87e-03 NA 0.042