Summary

Q2TAM9

Homolog: Q673H1.
Function: Tumor suppressor candidate gene 1 protein homolog.

Statistics

Total GO Annotation: 15
Unique PROST Go: 13
Unique BLAST Go: 2

Total Homologs: 14
Unique PROST Homologs: 6
Unique BLAST Homologs: 6

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q673H1 (Tumor suppressor candidate gene 1 protein homolog) with a FATCAT P-Value: 3.46e-06 and RMSD of 3.77 angstrom. The sequence alignment identity is 72.7%.
Structural alignment shown in left. Query protein Q2TAM9 colored as red in alignment, homolog Q673H1 colored as blue. Query protein Q2TAM9 is also shown in right top, homolog Q673H1 showed in right bottom. They are colored based on secondary structures. 

  Q2TAM9 MGPMWRMRGGATRRGSCCGGDGAADG-RG-PGRSGRARGGGSPSGGGGGVGWRGRADGARQQLEERFADLAASHLEAIRARDEWDRQNARLRQENARLRL 98
  Q673H1 ---MWRMRGGATRRGS-CGGEGG--GSRGESGRLGRAREGG---GGGGGVGWRGRAGGARRQLEERFADLAASHLEALRARDERDRQNARLREENARLRL 91

  Q2TAM9 ENRRLKRENRSLFRQALRLPGEGGNGTPAEARRV-PEEASTNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPLQEPD 197
  Q673H1 ENRRLRRENRSLFRQALRLPGDSGE-REAAVETLAPDEPATNRKARGHGREEEPGSPRALRARLEKLEVMYRRALLQLHLEQQGARPPGAIEEPPLQETA 190

  Q2TAM9 SGLRSRDSE-PSGPWL 212
  Q673H1 TGLCAHDPDVPR-PWL 205

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0008017 microtubule binding
2. P GO:0019901 protein kinase binding
2. P GO:0005813 centrosome
2. P GO:0051301 cell division
2. P GO:0010090 trichome morphogenesis
2. P GO:0000922 spindle pole
2. P GO:0070652 HAUS complex
2. P GO:0005880 nuclear microtubule
2. P GO:0031267 small GTPase binding
2. P GO:0051225 spindle assembly
2. P GO:1990498 mitotic spindle microtubule
2. P GO:0007098 centrosome cycle
2. P GO:0010091 trichome branching
3. B GO:0005737 cytoplasm
3. B GO:0005634 nucleus

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q673H1 Tumor suppressor candidate gene 1 protein homolog 3.46e-06 3.58e-48 1.33e-55
1. PB Q2TAM9 Tumor suppressor candidate gene 1 protein 0 2.28e-134 5.53e-144
2. P Q5BK57 HAUS augmin-like complex subunit 8 4.73e-04 3.53e-02 NA
2. P Q99L00 HAUS augmin-like complex subunit 8 9.86e-05 7.51e-03 NA
2. P F4I878 Protein BRANCHLESS TRICHOME 1.03e-04 4.95e-02 NA
2. P Q0VCF3 Suppressor of IKBKE 1 3.82e-05 2.47e-02 NA
2. P Q09350 Uncharacterized protein T09B9.4 1.03e-02 1.25e-02 NA
2. P Q9CPR7 Suppressor of IKBKE 1 8.06e-05 3.35e-02 NA
3. B Q9DA73 Coiled-coil domain-containing protein 89 2.64e-03 NA 1.00e-05
3. B Q29RS0 Coiled-coil domain-containing protein 89 9.57e-03 NA 1.01e-07
3. B A8WG43 Coiled-coil domain-containing protein 89 4.57e-03 NA 9.26e-06
3. B Q8N998 Coiled-coil domain-containing protein 89 4.84e-03 NA 2.09e-07
3. B Q95JI9 Coiled-coil domain-containing protein 89 6.00e-03 NA 1.26e-07
3. B B2RZ86 Coiled-coil domain-containing protein 89 4.08e-03 NA 4.54e-06