Results | PROST

Summary

Q2WGN9

Homolog: Q9ST43.
Function: Pleckstrin homology domain-containing protein 1.

Statistics

Total GO Annotation: 312
Unique PROST Go: 111
Unique BLAST Go: 130

Total Homologs: 132
Unique PROST Homologs: 59
Unique BLAST Homologs: 56

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q9ST43 (Pleckstrin homology domain-containing protein 1) with a FATCAT P-Value: 0.000382 and RMSD of 2.38 angstrom. The sequence alignment identity is 8.8%.
Structural alignment shown in left. Query protein Q2WGN9 colored as red in alignment, homolog Q9ST43 colored as blue. Query protein Q2WGN9 is also shown in right top, homolog Q9ST43 showed in right bottom. They are colored based on secondary structures.

  Q2WGN9 M-SL----PSPSPSRELCPPDPAFAPLSSWPGSGPAGGSTRSGHVLYSGWLRKSPPEKKLRLFAWRKRWFILRRGQTSSDPDVLEYYKND-------GSK 88
  Q9ST43 MESIWRIATGQDPSRE----D--YEGIEFW--SNPE----R------SGWLTKQGDYIK----TWRRRWFVLKRGK------LL-WFK-DQAAAGIRGS- 69

  Q2WGN9 KPLRTINLNLCEQLDV----DVTLNFNKKEIQKGYMFDIKTSERTFYLVAETREDMNEWVQSICQICGFRQEESTGFLGNISSASHGLCSSPAEPSCSHQ 184
  Q9ST43 TPRGVISVGDC--LTVKGAEDV-VN-------KPFAFELSSGSYTMFFIADNEKEKEEWINSI----G-R---------SIVQHSRSVTDSEV-LDYDHR 144

  Q2WGN9 HLPQEQEPTSEPPVSHCVPPTWPIPAPPGCLRSHQHASQRAEHARSASFSQGSEAPFIMRRNTAMQNLAQHSGYSVDGVSGHIHGFHSLSKPSQHNAEFR 284
  Q9ST43 R--------------------------------------------------------------------------------------------------- 145

  Q2WGN9 GSTHRIPWSLASHGHTRGSLTGSEADNEASSGKYTQHGGGNASRPAESMHEGVCSFLPGRTLVGLSDSIASEGSCVPMNPGSPTLPAVKQAGDDSQGVCI 384
  Q9ST43 ---------------------------------------------------------------------------------------------------- 145

  Q2WGN9 PVGSCLVRFDLLGSPLTELSMHQDLSQGHEVQLPPVNRSLKPNQKANPTPPNLRNNRVINELSFKPPVTEPWSGTSHTFDSSSSQHPISTQSITNTDSED 484
  Q9ST43 ---------------------------------------------------------------------------------------------------- 145

  Q2WGN9 SGERYLFPNPASAFPVSGGTSSSAPPRSTGNIHYAALDFQPSKPSIGSVTSGKKVDYVQVDLEKTQALQKTMHEQMCLRQSSEPPRGAKL 574
  Q9ST43 ------------------------------------------------------------------------------------------ 145

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0043491	protein kinase B signaling
1. PB	GO:0030879	mammary gland development
1. PB	GO:0005159	insulin-like growth factor receptor binding
1. PB	GO:0046676	negative regulation of insulin secretion
1. PB	GO:0010907	positive regulation of glucose metabolic process
1. PB	GO:0043306	positive regulation of mast cell degranulation
1. PB	GO:0030159	signaling receptor complex adaptor activity
1. PB	GO:0019904	protein domain specific binding
1. PB	GO:0071478	cellular response to radiation
1. PB	GO:0030316	osteoclast differentiation
1. PB	GO:0007229	integrin-mediated signaling pathway
1. PB	GO:0060711	labyrinthine layer development
1. PB	GO:0045500	sevenless signaling pathway
1. PB	GO:0007465	R7 cell fate commitment
1. PB	GO:0014065	phosphatidylinositol 3-kinase signaling
1. PB	GO:0015671	oxygen transport
1. PB	GO:0043434	response to peptide hormone
1. PB	GO:0005158	insulin receptor binding
1. PB	GO:1904385	cellular response to angiotensin
1. PB	GO:0002053	positive regulation of mesenchymal cell proliferation
1. PB	GO:0038089	positive regulation of cell migration by vascular endothelial growth factor signaling pathway
1. PB	GO:0071398	cellular response to fatty acid
1. PB	GO:0038084	vascular endothelial growth factor signaling pathway
1. PB	GO:0031532	actin cytoskeleton reorganization
1. PB	GO:0005080	protein kinase C binding
1. PB	GO:0046628	positive regulation of insulin receptor signaling pathway
1. PB	GO:0008286	insulin receptor signaling pathway
1. PB	GO:0019901	protein kinase binding
1. PB	GO:0008293	torso signaling pathway
1. PB	GO:0046578	regulation of Ras protein signal transduction
1. PB	GO:0042327	positive regulation of phosphorylation
1. PB	GO:0045725	positive regulation of glycogen biosynthetic process
1. PB	GO:0001784	phosphotyrosine residue binding
1. PB	GO:0005899	insulin receptor complex
1. PB	GO:0048009	insulin-like growth factor receptor signaling pathway
1. PB	GO:0032000	positive regulation of fatty acid beta-oxidation
1. PB	GO:0043325	phosphatidylinositol-3,4-bisphosphate binding
1. PB	GO:0043231	intracellular membrane-bounded organelle
1. PB	GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding
1. PB	GO:0005802	trans-Golgi network
1. PB	GO:0032868	response to insulin
1. PB	GO:0070094	positive regulation of glucagon secretion
1. PB	GO:0010634	positive regulation of epithelial cell migration
1. PB	GO:0046326	positive regulation of glucose import
1. PB	GO:0008595	anterior/posterior axis specification, embryo
1. PB	GO:0008284	positive regulation of cell population proliferation
1. PB	GO:0032587	ruffle membrane
1. PB	GO:0005543	phospholipid binding
1. PB	GO:0046627	negative regulation of insulin receptor signaling pathway
1. PB	GO:0090668	endothelial cell chemotaxis to vascular endothelial growth factor
1. PB	GO:0005829	cytosol
1. PB	GO:1990416	cellular response to brain-derived neurotrophic factor stimulus
1. PB	GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity
1. PB	GO:0005068	transmembrane receptor protein tyrosine kinase adaptor activity
1. PB	GO:0007173	epidermal growth factor receptor signaling pathway
1. PB	GO:0030225	macrophage differentiation
1. PB	GO:0019903	protein phosphatase binding
1. PB	GO:0048015	phosphatidylinositol-mediated signaling
1. PB	GO:0032869	cellular response to insulin stimulus
1. PB	GO:0035556	intracellular signal transduction
1. PB	GO:0042169	SH2 domain binding
1. PB	GO:0042461	photoreceptor cell development
1. PB	GO:0090275	negative regulation of somatostatin secretion
1. PB	GO:0031000	response to caffeine
1. PB	GO:0034504	protein localization to nucleus
1. PB	GO:0005938	cell cortex
1. PB	GO:0007165	signal transduction
1. PB	GO:0035728	response to hepatocyte growth factor
1. PB	GO:0035264	multicellular organism growth
1. PB	GO:0043548	phosphatidylinositol 3-kinase binding
1. PB	GO:0005901	caveola
2. P	GO:0005768	endosome
2. P	GO:0007565	female pregnancy
2. P	GO:0050775	positive regulation of dendrite morphogenesis
2. P	GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway
2. P	GO:0071888	macrophage apoptotic process
2. P	GO:0036195	muscle cell projection membrane
2. P	GO:0045177	apical part of cell
2. P	GO:1903688	positive regulation of border follicle cell migration
2. P	GO:0007285	primary spermatocyte growth
2. P	GO:0010008	endosome membrane
2. P	GO:0060250	germ-line stem-cell niche homeostasis
2. P	GO:0048568	embryonic organ development
2. P	GO:0050778	positive regulation of immune response
2. P	GO:0035621	ER to Golgi ceramide transport
2. P	GO:0001701	in utero embryonic development
2. P	GO:0007265	Ras protein signal transduction
2. P	GO:0007409	axonogenesis
2. P	GO:0050678	regulation of epithelial cell proliferation
2. P	GO:0070372	regulation of ERK1 and ERK2 cascade
2. P	GO:0005911	cell-cell junction
2. P	GO:0035159	regulation of tube length, open tracheal system
2. P	GO:0008340	determination of adult lifespan
2. P	GO:0009749	response to glucose
2. P	GO:0008543	fibroblast growth factor receptor signaling pathway
2. P	GO:0019897	extrinsic component of plasma membrane
2. P	GO:0072673	lamellipodium morphogenesis
2. P	GO:0005905	clathrin-coated pit
2. P	GO:0007405	neuroblast proliferation
2. P	GO:0097001	ceramide binding
2. P	GO:0050769	positive regulation of neurogenesis
2. P	GO:0098890	extrinsic component of postsynaptic membrane
2. P	GO:0007296	vitellogenesis
2. P	GO:0046619	lens placode formation involved in camera-type eye formation
2. P	GO:0046622	positive regulation of organ growth
2. P	GO:0007185	transmembrane receptor protein tyrosine phosphatase signaling pathway
2. P	GO:0016323	basolateral plasma membrane
2. P	GO:0070273	phosphatidylinositol-4-phosphate binding
2. P	GO:0098888	extrinsic component of presynaptic membrane
2. P	GO:0090148	membrane fission
2. P	GO:0007219	Notch signaling pathway
2. P	GO:0021670	lateral ventricle development
2. P	GO:0051451	myoblast migration
2. P	GO:0045296	cadherin binding
2. P	GO:0030890	positive regulation of B cell proliferation
2. P	GO:0061098	positive regulation of protein tyrosine kinase activity
2. P	GO:0007520	myoblast fusion
2. P	GO:0010259	multicellular organism aging
2. P	GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling
2. P	GO:0031234	extrinsic component of cytoplasmic side of plasma membrane
2. P	GO:0099150	regulation of postsynaptic specialization assembly
2. P	GO:0048133	male germ-line stem cell asymmetric division
2. P	GO:0033673	negative regulation of kinase activity
2. P	GO:0006869	lipid transport
2. P	GO:1903671	negative regulation of sprouting angiogenesis
2. P	GO:0035615	clathrin adaptor activity
2. P	GO:0060291	long-term synaptic potentiation
2. P	GO:1902388	ceramide 1-phosphate transfer activity
2. P	GO:0002903	negative regulation of B cell apoptotic process
2. P	GO:0043409	negative regulation of MAPK cascade
2. P	GO:0045294	alpha-catenin binding
2. P	GO:0030136	clathrin-coated vesicle
2. P	GO:0060527	prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis
2. P	GO:0045664	regulation of neuron differentiation
2. P	GO:0019211	phosphatase activator activity
2. P	GO:0030125	clathrin vesicle coat
2. P	GO:0009267	cellular response to starvation
2. P	GO:0017089	glycolipid transfer activity
2. P	GO:0006897	endocytosis
2. P	GO:0061964	negative regulation of entry into reproductive diapause
2. P	GO:0019538	protein metabolic process
2. P	GO:0005634	nucleus
2. P	GO:2000096	positive regulation of Wnt signaling pathway, planar cell polarity pathway
2. P	GO:0030276	clathrin binding
2. P	GO:0021849	neuroblast division in subventricular zone
2. P	GO:0098685	Schaffer collateral - CA1 synapse
2. P	GO:0030335	positive regulation of cell migration
2. P	GO:0042593	glucose homeostasis
2. P	GO:0003281	ventricular septum development
2. P	GO:0010748	negative regulation of long-chain fatty acid import across plasma membrane
2. P	GO:0038145	macrophage colony-stimulating factor signaling pathway
2. P	GO:0098794	postsynapse
2. P	GO:0040018	positive regulation of multicellular organism growth
2. P	GO:0099149	regulation of postsynaptic neurotransmitter receptor internalization
2. P	GO:0001759	organ induction
2. P	GO:0043410	positive regulation of MAPK cascade
2. P	GO:0005104	fibroblast growth factor receptor binding
2. P	GO:0035627	ceramide transport
2. P	GO:2000726	negative regulation of cardiac muscle cell differentiation
2. P	GO:1902387	ceramide 1-phosphate binding
2. P	GO:0007295	growth of a germarium-derived egg chamber
2. P	GO:0055088	lipid homeostasis
2. P	GO:0001702	gastrulation with mouth forming second
2. P	GO:0120009	intermembrane lipid transfer
2. P	GO:1903077	negative regulation of protein localization to plasma membrane
2. P	GO:0045793	positive regulation of cell size
2. P	GO:0071889	14-3-3 protein binding
2. P	GO:0007528	neuromuscular junction development
2. P	GO:0034332	adherens junction organization
2. P	GO:0060487	lung epithelial cell differentiation
2. P	GO:0032024	positive regulation of insulin secretion
2. P	GO:1905445	positive regulation of clathrin coat assembly
2. P	GO:0051861	glycolipid binding
2. P	GO:0005168	neurotrophin TRKA receptor binding
2. P	GO:0030900	forebrain development
2. P	GO:0034059	response to anoxia
2. P	GO:0008355	olfactory learning
2. P	GO:0070307	lens fiber cell development
2. P	GO:0030862	positive regulation of polarized epithelial cell differentiation
2. P	GO:0010897	negative regulation of triglyceride catabolic process
2. P	GO:0008013	beta-catenin binding
2. P	GO:0071333	cellular response to glucose stimulus
3. B	GO:0060021	roof of mouth development
3. B	GO:0030705	cytoskeleton-dependent intracellular transport
3. B	GO:0030845	phospholipase C-inhibiting G protein-coupled receptor signaling pathway
3. B	GO:0008209	androgen metabolic process
3. B	GO:0045111	intermediate filament cytoskeleton
3. B	GO:0044351	macropinocytosis
3. B	GO:0033625	positive regulation of integrin activation
3. B	GO:0051898	negative regulation of protein kinase B signaling
3. B	GO:0031702	type 1 angiotensin receptor binding
3. B	GO:0048705	skeletal system morphogenesis
3. B	GO:0099147	extrinsic component of postsynaptic density membrane
3. B	GO:0031254	cell trailing edge
3. B	GO:0110094	polyphosphate-mediated signaling
3. B	GO:0102205	cholesterol alpha-glucosyltransferase activity
3. B	GO:0004691	cAMP-dependent protein kinase activity
3. B	GO:0016906	sterol 3-beta-glucosyltransferase activity
3. B	GO:0030334	regulation of cell migration
3. B	GO:0006904	vesicle docking involved in exocytosis
3. B	GO:0051056	regulation of small GTPase mediated signal transduction
3. B	GO:0008289	lipid binding
3. B	GO:0048008	platelet-derived growth factor receptor signaling pathway
3. B	GO:0007032	endosome organization
3. B	GO:0035313	wound healing, spreading of epidermal cells
3. B	GO:0001881	receptor recycling
3. B	GO:0002576	platelet degranulation
3. B	GO:0001726	ruffle
3. B	GO:0051270	regulation of cellular component movement
3. B	GO:0046488	phosphatidylinositol metabolic process
3. B	GO:0002244	hematopoietic progenitor cell differentiation
3. B	GO:0051489	regulation of filopodium assembly
3. B	GO:0098978	glutamatergic synapse
3. B	GO:1904261	positive regulation of basement membrane assembly involved in embryonic body morphogenesis
3. B	GO:0090630	activation of GTPase activity
3. B	GO:0045184	establishment of protein localization
3. B	GO:0005524	ATP binding
3. B	GO:0010572	positive regulation of platelet activation
3. B	GO:0030175	filopodium
3. B	GO:0043005	neuron projection
3. B	GO:0070493	thrombin-activated receptor signaling pathway
3. B	GO:0042995	cell projection
3. B	GO:0032060	bleb assembly
3. B	GO:0032433	filopodium tip
3. B	GO:0030835	negative regulation of actin filament depolymerization
3. B	GO:2001114	positive regulation of cellular response to hepatocyte growth factor stimulus
3. B	GO:0043025	neuronal cell body
3. B	GO:0031252	cell leading edge
3. B	GO:0005886	plasma membrane
3. B	GO:0030030	cell projection organization
3. B	GO:0022409	positive regulation of cell-cell adhesion
3. B	GO:0030165	PDZ domain binding
3. B	GO:0030037	actin filament reorganization involved in cell cycle
3. B	GO:0045744	negative regulation of G protein-coupled receptor signaling pathway
3. B	GO:0009791	post-embryonic development
3. B	GO:0005856	cytoskeleton
3. B	GO:0031154	culmination involved in sorocarp development
3. B	GO:1903690	negative regulation of wound healing, spreading of epidermal cells
3. B	GO:0030864	cortical actin cytoskeleton
3. B	GO:0010470	regulation of gastrulation
3. B	GO:0090136	epithelial cell-cell adhesion
3. B	GO:0005912	adherens junction
3. B	GO:0032580	Golgi cisterna membrane
3. B	GO:0051895	negative regulation of focal adhesion assembly
3. B	GO:0030836	positive regulation of actin filament depolymerization
3. B	GO:0060325	face morphogenesis
3. B	GO:0051497	negative regulation of stress fiber assembly
3. B	GO:0043547	positive regulation of GTPase activity
3. B	GO:0010920	negative regulation of inositol phosphate biosynthetic process
3. B	GO:0032233	positive regulation of actin filament bundle assembly
3. B	GO:0099175	regulation of postsynapse organization
3. B	GO:0005096	GTPase activator activity
3. B	GO:0033327	Leydig cell differentiation
3. B	GO:0005085	guanyl-nucleotide exchange factor activity
3. B	GO:0043236	laminin binding
3. B	GO:0031529	ruffle organization
3. B	GO:0009966	regulation of signal transduction
3. B	GO:0005915	zonula adherens
3. B	GO:0070301	cellular response to hydrogen peroxide
3. B	GO:0030027	lamellipodium
3. B	GO:0102202	soladodine glucosyltransferase activity
3. B	GO:0000146	microfilament motor activity
3. B	GO:0048870	cell motility
3. B	GO:0001968	fibronectin binding
3. B	GO:0031149	sorocarp stalk cell differentiation
3. B	GO:0050853	B cell receptor signaling pathway
3. B	GO:1905303	positive regulation of macropinocytosis
3. B	GO:0009920	cell plate formation involved in plant-type cell wall biogenesis
3. B	GO:0001782	B cell homeostasis
3. B	GO:0045218	zonula adherens maintenance
3. B	GO:0070528	protein kinase C signaling
3. B	GO:0005516	calmodulin binding
3. B	GO:0016459	myosin complex
3. B	GO:0042147	retrograde transport, endosome to Golgi
3. B	GO:0090382	phagosome maturation
3. B	GO:0001921	positive regulation of receptor recycling
3. B	GO:0051015	actin filament binding
3. B	GO:1903013	response to differentiation-inducing factor 1
3. B	GO:0099173	postsynapse organization
3. B	GO:0001553	luteinization
3. B	GO:0070527	platelet aggregation
3. B	GO:0051491	positive regulation of filopodium assembly
3. B	GO:0030507	spectrin binding
3. B	GO:0102203	brassicasterol glucosyltransferase activity
3. B	GO:0001525	angiogenesis
3. B	GO:1900028	negative regulation of ruffle assembly
3. B	GO:0050849	negative regulation of calcium-mediated signaling
3. B	GO:0060997	dendritic spine morphogenesis
3. B	GO:0043087	regulation of GTPase activity
3. B	GO:0060002	plus-end directed microfilament motor activity
3. B	GO:0002315	marginal zone B cell differentiation
3. B	GO:0010717	regulation of epithelial to mesenchymal transition
3. B	GO:0070560	protein secretion by platelet
3. B	GO:0031036	myosin II filament assembly
3. B	GO:0070097	delta-catenin binding
3. B	GO:0031527	filopodium membrane
3. B	GO:0007264	small GTPase mediated signal transduction
3. B	GO:0005925	focal adhesion
3. B	GO:0030866	cortical actin cytoskeleton organization
3. B	GO:0044331	cell-cell adhesion mediated by cadherin
3. B	GO:0070685	macropinocytic cup
3. B	GO:0008210	estrogen metabolic process
3. B	GO:0060305	regulation of cell diameter
3. B	GO:0070507	regulation of microtubule cytoskeleton organization
3. B	GO:0010925	positive regulation of inositol-polyphosphate 5-phosphatase activity
3. B	GO:0001954	positive regulation of cell-matrix adhesion
3. B	GO:0045180	basal cortex
3. B	GO:0035021	negative regulation of Rac protein signal transduction
3. B	GO:0043327	chemotaxis to cAMP
3. B	GO:0046580	negative regulation of Ras protein signal transduction
3. B	GO:0044354	macropinosome
3. B	GO:0005654	nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	A6QLU3	GRB2-associated-binding protein 1	4.84e-04	9.74e-11	4.35e-47
1. PB	Q2WGN9	GRB2-associated-binding protein 4	0	2.68e-136	0.0
1. PB	Q13480	GRB2-associated-binding protein 1	1.14e-02	9.48e-13	3.18e-47
1. PB	Q8WWN9	Interactor protein for cytohesin exchange factors 1	5.66e-03	3.91e-06	0.009
1. PB	Q99PF6	GRB2-associated-binding protein 1	7.75e-03	2.21e-14	4.37e-49
1. PB	Q8WWW8	GRB2-associated-binding protein 3	6.90e-04	1.01e-23	7.57e-34
1. PB	P35568	Insulin receptor substrate 1	8.29e-02	4.57e-04	4.37e-05
1. PB	P35570	Insulin receptor substrate 1	4.48e-01	5.00e-02	4.19e-05
1. PB	Q9VZZ9	Protein daughter of sevenless	1.82e-02	3.19e-05	4.12e-21
1. PB	Q9UQC2	GRB2-associated-binding protein 2	3.09e-03	2.35e-14	6.66e-114
1. PB	Q9EQH1	GRB2-associated-binding protein 2	2.96e-02	5.20e-17	2.71e-104
1. PB	Q9Z1S8	GRB2-associated-binding protein 2	1.68e-03	1.13e-17	3.64e-107
1. PB	Q9QYY0	GRB2-associated-binding protein 1	7.04e-04	1.60e-12	1.02e-47
1. PB	Q8BSM5	GRB2-associated-binding protein 3	1.24e-02	1.29e-20	1.67e-34
1. PB	Q5SXH7	Pleckstrin homology domain-containing family S member 1	2.27e-01	6.09e-03	0.002
1. PB	P35569	Insulin receptor substrate 1	6.89e-01	4.19e-03	4.29e-05
1. PB	Q28224	Insulin receptor substrate 1	1.39e-01	3.26e-03	6.07e-06
2. P	Q8WU20	Fibroblast growth factor receptor substrate 2	6.86e-02	2.61e-07	NA
2. P	Q56A36	Hematopoietic SH2 domain-containing protein homolog	3.90e-01	4.70e-02	NA
2. P	Q5RJW5	Insulin receptor substrate 2-B	2.86e-01	2.07e-08	NA
2. P	Q53GL0	Pleckstrin homology domain-containing family O member 1	1.03e-01	1.61e-08	NA
2. P	O43559	Fibroblast growth factor receptor substrate 3	7.83e-02	5.97e-08	NA
2. P	O88339	Epsin-1	6.95e-01	1.07e-03	NA
2. P	G5EDJ4	Multisubstrate adapter protein soc-1	5.09e-02	1.56e-20	NA
2. P	Q06649	SH3 domain-binding protein 2	6.25e-02	1.55e-08	NA
2. P	Q6P4Y6	Insulin receptor substrate 1	2.83e-02	3.05e-05	NA
2. P	Q9Y6I3	Epsin-1	5.22e-01	4.89e-03	NA
2. P	Q9XTN2	Insulin receptor substrate 1	9.22e-02	5.82e-08	NA
2. P	B3N946	Insulin receptor substrate 1	2.85e-01	5.95e-06	NA
2. P	Q9Y4H2	Insulin receptor substrate 2	2.92e-01	5.28e-07	NA
2. P	Q80W71	Pleckstrin homology domain-containing family A member 8	2.74e-01	3.28e-02	NA
2. P	A7MBB8	Docking protein 2	7.53e-02	4.78e-08	NA
2. P	B2RYG7	Docking protein 3	1.92e-01	3.80e-04	NA
2. P	Q8VY07	Clathrin interactor EPSIN 1	3.14e-01	4.25e-02	NA
2. P	Q5BJM5	Pleckstrin homology domain-containing family O member 1	1.20e-01	2.15e-06	NA
2. P	A3R064	Docking protein 3	9.18e-02	2.22e-04	NA
2. P	Q9QZS3	Protein numb homolog	1.31e-01	2.13e-04	NA
2. P	Q18PD9	Protein Dok-7	4.26e-02	7.89e-05	NA
2. P	P81122	Insulin receptor substrate 2	1.84e-01	8.78e-07	NA
2. P	P84770	Insulin receptor substrate 1-B	1.54e-01	9.99e-07	NA
2. P	B4HWI2	Insulin receptor substrate 1	2.89e-01	1.40e-06	NA
2. P	Q9QZK7	Docking protein 3	5.24e-02	2.94e-04	NA
2. P	Q2LC84	Protein numb homolog	4.28e-02	1.41e-02	NA
2. P	Q8IYW4	ENTH domain-containing protein 1	3.01e-02	2.68e-04	NA
2. P	Q8C180	Fibroblast growth factor receptor substrate 2	1.03e-01	3.82e-06	NA
2. P	Q8K124	Pleckstrin homology domain-containing family O member 2	5.08e-02	7.78e-09	NA
2. P	Q5DU31	Interactor protein for cytohesin exchange factors 1	3.25e-02	2.53e-06	NA
2. P	Q9JIY0	Pleckstrin homology domain-containing family O member 1	7.00e-02	5.60e-07	NA
2. P	O60496	Docking protein 2	8.15e-02	4.11e-08	NA
2. P	Q80VL0	Interactor protein for cytohesin exchange factors 1	4.95e-02	3.87e-06	NA
2. P	Q5EA84	Docking protein 1	3.89e-02	2.01e-06	NA
2. P	B3MPN6	Insulin receptor substrate 1	1.01e-01	6.59e-08	NA
2. P	Q5F3C8	Pleckstrin homology domain-containing family O member 1	1.31e-01	3.64e-09	NA
2. P	Q8TD55	Pleckstrin homology domain-containing family O member 2	5.72e-02	1.22e-09	NA
2. P	A6NKC9	SH2 domain-containing protein 7	5.56e-02	3.05e-05	NA
2. P	F1MS15	Pleckstrin homology domain-containing family A member 8	3.39e-01	1.95e-02	NA
2. P	A4IFK0	Pleckstrin homology domain-containing family O member 1	2.06e-02	4.80e-07	NA
2. P	P49757	Protein numb homolog	8.13e-02	4.76e-04	NA
2. P	Q18PE0	Protein Dok-7	1.63e-01	3.16e-04	NA
2. P	Q52RG8	Fibroblast growth factor receptor substrate 3	3.27e-01	1.73e-09	NA
2. P	B4NZ70	Insulin receptor substrate 1	2.65e-02	3.08e-06	NA
2. P	Q18PE1	Protein Dok-7	3.19e-02	1.27e-02	NA
2. P	Q8VC98	Pleckstrin homology domain-containing family A member 4	2.75e-01	4.70e-02	NA
2. P	Q91WJ0	Fibroblast growth factor receptor substrate 3	6.65e-02	1.16e-07	NA
2. P	A4IG55	Pleckstrin homology domain-containing family O member 1-A	5.72e-02	1.43e-08	NA
2. P	D3ZY60	Pleckstrin homology domain-containing family A member 8	2.74e-01	2.11e-02	NA
2. P	P78314	SH3 domain-binding protein 2	1.49e-02	7.16e-10	NA
2. P	Q80VP1	Epsin-1	6.98e-01	2.02e-03	NA
2. P	O70469	Docking protein 2	1.24e-01	6.44e-06	NA
2. P	Q99704	Docking protein 1	2.24e-01	2.13e-04	NA
2. P	O08919	Numb-like protein	3.15e-01	1.32e-02	NA
2. P	Q9DF49	Insulin receptor substrate 2-A	7.95e-02	2.81e-09	NA
2. P	Q32LQ1	Pleckstrin homology domain-containing family O member 2	5.33e-03	2.53e-09	NA
2. P	P97465	Docking protein 1	1.46e-01	2.14e-03	NA
2. P	Q8BI17	SH2 domain-containing protein 7	1.10e-01	2.22e-04	NA
2. P	Q4QQV2	Docking protein 1	9.89e-02	2.95e-05	NA
3. B	Q9UN19	Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide	2.51e-02	NA	3.49e-04
3. B	Q4KM33	Pleckstrin	2.16e-02	NA	0.008
3. B	P58069	Ras GTPase-activating protein 2	1.98e-01	NA	0.050
3. B	Q0UY53	Sterol 3-beta-glucosyltransferase	7.84e-01	NA	8.84e-04
3. B	Q54KA7	Ankyrin repeat, PH and SEC7 domain containing protein secG	3.44e-01	NA	0.005
3. B	Q86SQ0	Pleckstrin homology-like domain family B member 2	7.81e-01	NA	0.004
3. B	Q8BUL6	Pleckstrin homology domain-containing family A member 1	9.13e-03	NA	1.62e-05
3. B	Q7Z5H3	Rho GTPase-activating protein 22	3.88e-01	NA	7.33e-04
3. B	Q3ZBA3	Pleckstrin homology domain-containing family A member 2	6.03e-02	NA	2.94e-07
3. B	Q8BZN6	Dedicator of cytokinesis protein 10	8.86e-01	NA	4.39e-04
3. B	Q96BY6	Dedicator of cytokinesis protein 10	8.19e-01	NA	4.14e-04
3. B	P08567	Pleckstrin	6.81e-03	NA	0.003
3. B	G9CGD6	CNK3/IPCEF1 fusion protein	7.96e-02	NA	0.013
3. B	Q63713	Ras GTPase-activating protein 2	2.11e-01	NA	0.015
3. B	P79114	Unconventional myosin-X	9.64e-01	NA	4.52e-06
3. B	Q8IVE3	Pleckstrin homology domain-containing family H member 2	6.26e-01	NA	0.013
3. B	Q63312	Pleckstrin homology-like domain family B member 1 (Fragment)	7.63e-01	NA	0.015
3. B	Q9QXT1	Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide	4.49e-02	NA	2.69e-04
3. B	Q8C115	Pleckstrin homology domain-containing family H member 2	8.12e-01	NA	0.005
3. B	Q8C4V1	Rho GTPase-activating protein 24	1.20e-01	NA	4.06e-04
3. B	Q8WXI2	Connector enhancer of kinase suppressor of ras 2	1.45e-01	NA	0.017
3. B	Q80TI1	Pleckstrin homology domain-containing family H member 1	6.99e-01	NA	2.18e-04
3. B	Q9FMP8	Rho GTPase-activating protein 6	6.37e-01	NA	0.011
3. B	Q6WCQ1	Myosin phosphatase Rho-interacting protein	1.46e-01	NA	0.035
3. B	Q9JHK5	Pleckstrin	7.07e-03	NA	0.002
3. B	Q80YA9	Connector enhancer of kinase suppressor of ras 2	4.65e-02	NA	0.016
3. B	Q9ULM0	Pleckstrin homology domain-containing family H member 1	7.13e-01	NA	5.21e-04
3. B	Q8N264	Rho GTPase-activating protein 24	2.14e-01	NA	0.004
3. B	Q9ST43	Pleckstrin homology domain-containing protein 1	3.82e-04	NA	6.65e-05
3. B	F8VQB6	Unconventional myosin-X	9.41e-01	NA	7.17e-06
3. B	Q96P48	Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1	8.65e-01	NA	7.62e-05
3. B	Q8K1N2	Pleckstrin homology-like domain family B member 2	7.08e-01	NA	0.004
3. B	Q9Z1T4	Connector enhancer of kinase suppressor of ras 2	1.29e-01	NA	0.018
3. B	B6RSP1	Pleckstrin homology domain-containing family A member 7	2.34e-01	NA	0.002
3. B	Q8RWQ4	Rho GTPase-activating protein 7	5.81e-01	NA	0.015
3. B	P54644	RAC family serine/threonine-protein kinase homolog	1.73e-02	NA	2.72e-06
3. B	Q15283	Ras GTPase-activating protein 2	8.16e-02	NA	0.010
3. B	Q8BL80	Rho GTPase-activating protein 22	5.30e-01	NA	2.43e-05
3. B	Q86IV4	PH domain-containing protein DDB_G0274775	8.28e-02	NA	3.42e-06
3. B	Q9W5D0	Uncharacterized protein CG43867	8.66e-01	NA	1.59e-05
3. B	Q4LDD4	Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1	9.50e-01	NA	0.001
3. B	Q8N4B1	Sesquipedalian-1	1.82e-01	NA	0.004
3. B	Q6NSJ2	Pleckstrin homology-like domain family B member 3	8.58e-01	NA	0.001
3. B	Q9HB19	Pleckstrin homology domain-containing family A member 2	1.68e-02	NA	2.94e-07
3. B	Q9HB21	Pleckstrin homology domain-containing family A member 1	6.88e-02	NA	9.07e-06
3. B	Q5U2Z7	Rho GTPase-activating protein 24	6.17e-01	NA	0.001
3. B	Q8BW88	Pleckstrin homology domain-containing family S member 1	2.40e-02	NA	0.002
3. B	Q9Y2H5	Pleckstrin homology domain-containing family A member 6	6.24e-02	NA	0.036
3. B	Q9ERS5	Pleckstrin homology domain-containing family A member 2	1.27e-01	NA	3.12e-07
3. B	Q00IB7	Pleckstrin homology domain-containing family H member 1	6.64e-01	NA	0.004
3. B	Q6PDH0	Pleckstrin homology-like domain family B member 1	4.36e-01	NA	8.62e-04
3. B	Q9HD67	Unconventional myosin-X	9.87e-01	NA	3.98e-06
3. B	D3ZJP6	Unconventional myosin-X	9.00e-01	NA	7.41e-06
3. B	Q55AN8	PH and Rap-GAP domain-containing protein DDB_G0271806	4.96e-01	NA	0.006
3. B	Q6IQ23	Pleckstrin homology domain-containing family A member 7	7.86e-02	NA	0.009
3. B	Q86UU1	Pleckstrin homology-like domain family B member 1	9.04e-01	NA	0.001