Summary

Q32M84

Homolog: Q32L18.
Function: BTB/POZ domain-containing protein 16.

Statistics

Total GO Annotation: 75
Unique PROST Go: 53
Unique BLAST Go: 7

Total Homologs: 52
Unique PROST Homologs: 41
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q32L18 (BTB/POZ domain-containing protein 16) with a FATCAT P-Value: 0.0 and RMSD of 2.82 angstrom. The sequence alignment identity is 74.3%.
Structural alignment shown in left. Query protein Q32M84 colored as red in alignment, homolog Q32L18 colored as blue. Query protein Q32M84 is also shown in right top, homolog Q32L18 showed in right bottom. They are colored based on secondary structures. 

  Q32M84 MIMSNTHKARLERRVTGSTNRWRLPKQPFSGDLLSLSQMCKALSIDFEEALRNPDRLCISQIQKFFFENFKNKDIQSGEADVILECLGFKWELHQPQLFQ 100
  Q32L18 MKMLNPQKPRLERRIAGSTNRWRFPRQPFSGDLLGLSQMCKAANIDFDEVLKNPDRLCISQIQKIFPENLKNKTIQSREADVILECLGFKWELHQPQLFQ 100

  Q32M84 SETLAKLYLKALAQGTTHPLRELEELLRAQSPKKTKEKSPAKRIIISLKINDPLVTKVAFATALKNLYMSEVEINLEDLLGVLASAHILQFSGLFQRCVD 200
  Q32L18 SETLAKLYLMGLARGNANPEKESVKILQAQQPGRSREQRP-------VKINDPLVTREAFATALKNLYMQEVKICLDDVLGVLAAAHILQFGSLFQRCVT 193

  Q32M84 VMIARLKPSTIKKFYEAGCKYKEEQLTTGCEKWLEMNLVPLGGTQIHLHKIPQDLLHKVLKSPRLFTFSEFHLLKTMLLWVFLQLNYKIQAIPTYETVMT 300
  Q32L18 VMMSGLTPSTIKNFYLAGCKYKEEPLTTACEKWMEMNLVPLVGTQIHLRKIPKELLHKVLKSPRLFTFSEFDLLKTLLLWVYLQLNNKTQTFPMYQTVLM 293

  Q32M84 FFKSFPENCCFLDRDIGRSLRPLFLCLRLHGITKGKDLEVLRHLNFFPESWLDQVTVNHYHALENGGDMVHLKDLNTQAVRFGLLFNQENTTYSKTIALY 400
  Q32L18 FFSSFPKNCAFLDRDVGQNLIPLFLCLRLHSITKGKDLEELRHINFFPESWLVRVTANHYHALENGGDMAHVKDLSTQAVRFGRLFNQEYTTHSKVITLY 393

  Q32M84 GFFFKIKGLKHDTTSYSFYMQRIKHTDLESPSAVYEHNHVSLRAARLVKYEIRAEALVDGKWQEFRTNQIKQKFGLTTSSCKSHTLKIQTVGIPIYVSFA 500
  Q32L18 GFFFEIKGIKHDTTSYSFHMQRIRHTDLECASTVYENTPISLRAERLVTYEIRAQTTVDGKWQEFRTNQITQKFGLAEPSCKSHALKIQTVGIPIYASFS 493

  Q32M84 FIFPAS 506
  Q32L18 FVFSLS 499

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0016567 protein ubiquitination
1. PB GO:0007281 germ cell development
1. PB GO:0016363 nuclear matrix
1. PB GO:0007283 spermatogenesis
1. PB GO:0097602 cullin family protein binding
1. PB GO:0034399 nuclear periphery
1. PB GO:0007278 pole cell fate determination
1. PB GO:0007315 pole plasm assembly
1. PB GO:0120177 negative regulation of torso signaling pathway
1. PB GO:0005634 nucleus
1. PB GO:1990756 ubiquitin ligase-substrate adaptor activity
1. PB GO:0016480 negative regulation of transcription by RNA polymerase III
1. PB GO:0031463 Cul3-RING ubiquitin ligase complex
1. PB GO:0007279 pole cell formation
1. PB GO:0005635 nuclear envelope
2. P GO:0031152 aggregation involved in sorocarp development
2. P GO:0010229 inflorescence development
2. P GO:0010588 cotyledon vascular tissue pattern formation
2. P GO:0010087 phloem or xylem histogenesis
2. P GO:0009409 response to cold
2. P GO:0009944 polarity specification of adaxial/abaxial axis
2. P GO:0001709 cell fate determination
2. P GO:0080022 primary root development
2. P GO:0010305 leaf vascular tissue pattern formation
2. P GO:0048439 flower morphogenesis
2. P GO:0010254 nectary development
2. P GO:0048367 shoot system development
2. P GO:0009954 proximal/distal pattern formation
2. P GO:0005576 extracellular region
2. P GO:0007517 muscle organ development
2. P GO:0048825 cotyledon development
2. P GO:0022008 neurogenesis
2. P GO:0090543 Flemming body
2. P GO:0005615 extracellular space
2. P GO:0050767 regulation of neurogenesis
2. P GO:0007155 cell adhesion
2. P GO:0005516 calmodulin binding
2. P GO:0010200 response to chitin
2. P GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway
2. P GO:0005044 scavenger receptor activity
2. P GO:0009751 response to salicylic acid
2. P GO:0016338 calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules
2. P GO:0043063 intercellular bridge organization
2. P GO:0045071 negative regulation of viral genome replication
2. P GO:0043393 regulation of protein binding
2. P GO:0016020 membrane
2. P GO:0010582 floral meristem determinacy
2. P GO:0031089 platelet dense granule lumen
2. P GO:0010022 meristem determinacy
2. P GO:0009723 response to ethylene
2. P GO:0009965 leaf morphogenesis
2. P GO:0021987 cerebral cortex development
2. P GO:0005829 cytosol
2. P GO:0042542 response to hydrogen peroxide
2. P GO:0036464 cytoplasmic ribonucleoprotein granule
2. P GO:0048813 dendrite morphogenesis
2. P GO:0000932 P-body
2. P GO:0006968 cellular defense response
2. P GO:0009911 positive regulation of flower development
2. P GO:0009733 response to auxin
2. P GO:0031154 culmination involved in sorocarp development
2. P GO:0010540 basipetal auxin transport
2. P GO:0010227 floral organ abscission
2. P GO:0010434 bract formation
2. P GO:0010114 response to red light
2. P GO:0072562 blood microparticle
2. P GO:0042802 identical protein binding
2. P GO:0045176 apical protein localization
3. B GO:0050853 B cell receptor signaling pathway
3. B GO:0002467 germinal center formation
3. B GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
3. B GO:0005938 cell cortex
3. B GO:0005643 nuclear pore
3. B GO:0000209 protein polyubiquitination
3. B GO:0031234 extrinsic component of cytoplasmic side of plasma membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8NEA9 Germ cell-less protein-like 2 1.51e-10 4.93e-35 1.51e-15
1. PB Q32L18 BTB/POZ domain-containing protein 16 0.00e+00 2.17e-82 0.0
1. PB Q6AXU1 BTB/POZ domain-containing protein 16 0.00e+00 1.12e-75 0.0
1. PB Q32M84 BTB/POZ domain-containing protein 16 0 2.02e-145 0.0
1. PB Q01820 Protein germ cell-less 3.62e-11 2.17e-08 2.95e-20
1. PB Q99N64 Germ cell-less protein-like 2 4.33e-15 7.71e-41 4.61e-08
1. PB Q920G9 Germ cell-less protein-like 1 9.92e-12 4.55e-34 5.85e-15
1. PB Q95J53 BTB/POZ domain-containing protein 16 0.00e+00 1.29e-95 0.0
1. PB E9Q173 BTB/POZ domain-containing protein 16 0.00e+00 1.22e-76 0.0
1. PB Q96IK5 Germ cell-less protein-like 1 1.11e-10 2.50e-37 7.96e-14
2. P P58544 BTB/POZ domain-containing protein 1 2.24e-05 4.61e-13 NA
2. P Q6EJ98 BTB/POZ and TAZ domain-containing protein 5 1.26e-03 1.27e-04 NA
2. P Q9C9Z0 Putative BTB/POZ domain-containing protein At3g08660 3.89e-03 3.25e-02 NA
2. P Q9DB72 BTB/POZ domain-containing protein 17 1.66e-06 3.49e-25 NA
2. P Q6GLJ1 BTB/POZ domain-containing protein 17 4.30e-07 6.21e-23 NA
2. P O04615 BTB/POZ domain-containing protein At4g01160 4.73e-05 6.16e-16 NA
2. P Q07797 Galectin-3-binding protein 4.12e-06 1.11e-15 NA
2. P Q9LFU0 BTB/POZ domain-containing protein DOT3 1.59e-02 1.99e-03 NA
2. P Q9FPW6 BTB/POZ domain-containing protein POB1 1.30e-05 3.66e-14 NA
2. P Q8H1D3 BTB/POZ domain-containing protein NPY1 8.81e-04 2.69e-02 NA
2. P A0A2K3DDJ2 Proteome of basal body protein 15 3.03e-01 3.83e-13 NA
2. P Q96KE9 BTB/POZ domain-containing protein 6 1.56e-04 2.64e-16 NA
2. P Q9BX70 BTB/POZ domain-containing protein 2 1.13e-04 1.48e-14 NA
2. P Q9LUB9 BTB/POZ domain-containing protein At5g48130 5.02e-03 7.59e-04 NA
2. P A9JRD8 BTB/POZ domain-containing protein 6-A 1.59e-04 3.92e-11 NA
2. P Q0V9W6 BTB/POZ domain-containing protein 6 3.26e-04 3.70e-11 NA
2. P M3XQV7 BTB/POZ domain-containing protein 3 1.38e-04 4.46e-11 NA
2. P P58545 BTB/POZ domain-containing protein 3 1.88e-04 1.03e-12 NA
2. P A7E3W2 Galectin-3-binding protein 8.56e-06 8.61e-12 NA
2. P Q9SYL0 BTB/POZ and TAZ domain-containing protein 3 3.65e-03 1.89e-03 NA
2. P Q5TZE1 BTB/POZ domain-containing protein 6-B 3.68e-04 9.53e-14 NA
2. P Q24JV9 Galectin-3-binding protein A 3.39e-05 2.75e-10 NA
2. P Q9M2W8 BTB/POZ domain-containing protein At3g49900 4.37e-04 7.66e-05 NA
2. P P34325 Cytokinesis defective protein 7 2.05e-03 3.38e-02 NA
2. P Q9M1I7 Regulatory protein NPR6 1.11e-02 3.82e-02 NA
2. P Q66KD0 BTB/POZ domain-containing protein 17 5.77e-06 2.33e-23 NA
2. P Q8K2J9 BTB/POZ domain-containing protein 6 2.98e-04 2.31e-19 NA
2. P Q54D84 Trishanku 4.45e-02 1.35e-03 NA
2. P O70513 Galectin-3-binding protein 2.56e-05 6.76e-15 NA
2. P A6NE02 BTB/POZ domain-containing protein 17 1.79e-06 7.59e-26 NA
2. P O82253 BTB/POZ domain-containing protein SETH6 2.76e-02 2.14e-02 NA
2. P P70117 Galectin-3-binding protein 2.54e-05 9.41e-12 NA
2. P F7ASZ0 BTB/POZ domain-containing protein 3 2.88e-04 9.83e-14 NA
2. P Q08380 Galectin-3-binding protein 2.96e-05 3.81e-17 NA
2. P Q5RDA4 Galectin-3-binding protein 1.11e-05 4.67e-17 NA
2. P Q9H0C5 BTB/POZ domain-containing protein 1 3.63e-05 1.22e-14 NA
2. P Q9Y2F9 BTB/POZ domain-containing protein 3 1.92e-04 2.73e-13 NA
2. P Q6NY73 Galectin-3-binding protein B 1.96e-05 1.98e-11 NA
2. P Q9SVM0 BTB/POZ domain-containing protein At3g50780 4.46e-02 2.99e-03 NA
2. P Q2LE78 BTB/POZ domain-containing protein 6 1.07e-04 1.08e-12 NA
2. P O82343 BTB/POZ domain-containing protein At2g46260 3.20e-05 2.16e-12 NA
3. B Q8WZ60 Kelch-like protein 6 1.13e-04 NA 0.003