Summary

Q32M92

Homolog: B9GXD6.
Function: CASP-like protein 3A1.

Statistics

Total GO Annotation: 26
Unique PROST Go: 26
Unique BLAST Go: 0

Total Homologs: 33
Unique PROST Homologs: 32
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was B9GXD6 (CASP-like protein 3A1) with a FATCAT P-Value: 0.00187 and RMSD of 3.00 angstrom. The sequence alignment identity is 21.1%.
Structural alignment shown in left. Query protein Q32M92 colored as red in alignment, homolog B9GXD6 colored as blue. Query protein Q32M92 is also shown in right top, homolog B9GXD6 showed in right bottom. They are colored based on secondary structures. 

  Q32M92 --MNKRTSVDASKEDLHP-AD-----PQSGEGVPPNRKNTKTSP----RGEGTAP---PFSARPC------VWTLCEMLSILALVGVLHPFYRSNN-QVY 78
  B9GXD6 MMMN------GQK--LAPAAEVAVQLPES-KVAADNISGTMSGPLVGASGGGTTAAMRPF-GRKAEVMHVLLRLLC-IITSVAALSFMFTAQQSSTISIY 89

  Q32M92 Q-KL----K---TH----LRCQSSRV--DGLMLKPTLLTPSQL--KSPEGHLILPTFNH--LVIRHILDPKQIFCVADVCTDCKFNCG--SIERHQKRH- 157
  B9GXD6 GFMLPVQSKWSFSHSFEYLVGVSAAVAAHSL-LQ-LLISMSRLLRKSP----VIPSRSHAWLIF--AGD--QVFAYAMISAGAAAS-GVTNLNRTGIQHT 178

  Q32M92 -LMRVS---QDW-EHL---IRYRNQIC--LS--------------- 178
  B9GXD6 ALPNFCKPLQSFCDHVAVSIFFTFTSCFLLAASAVQEVIWLSRSKY 224

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0048471 perinuclear region of cytoplasm
2. P GO:0048226 Casparian strip
2. P GO:0005886 plasma membrane
2. P GO:0019031 viral envelope
2. P GO:1902004 positive regulation of amyloid-beta formation
2. P GO:0010977 negative regulation of neuron projection development
2. P GO:0030182 neuron differentiation
2. P GO:0070062 extracellular exosome
2. P GO:0019064 fusion of virus membrane with host plasma membrane
2. P GO:2001238 positive regulation of extrinsic apoptotic signaling pathway
2. P GO:0000139 Golgi membrane
2. P GO:0001540 amyloid-beta binding
2. P GO:0010008 endosome membrane
2. P GO:0030660 Golgi-associated vesicle membrane
2. P GO:0007043 cell-cell junction assembly
2. P GO:0005764 lysosome
2. P GO:0005794 Golgi apparatus
2. P GO:0005615 extracellular space
2. P GO:0031301 integral component of organelle membrane
2. P GO:0016021 integral component of membrane
2. P GO:0055036 virion membrane
2. P GO:0042985 negative regulation of amyloid precursor protein biosynthetic process
2. P GO:0005765 lysosomal membrane
2. P GO:0042545 cell wall modification
2. P GO:0051539 4 iron, 4 sulfur cluster binding
2. P GO:0046740 transport of virus in host, cell to cell

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q32M92 Uncharacterized protein C15orf32 0 3.28e-138 5.45e-133
2. P P68622 Protein L5 NA 6.86e-03 NA
2. P A5A6H8 Integral membrane protein 2B 5.17e-02 2.37e-03 NA
2. P Q60HC1 Integral membrane protein 2B 8.83e-02 2.37e-03 NA
2. P Q07520 Movement protein TGBp3 NA 2.88e-05 NA
2. P A7NW79 CASP-like protein 1D1 3.20e-03 2.49e-03 NA
2. P P68623 Protein L5 NA 6.86e-03 NA
2. P Q8N8G6 Putative uncharacterized protein encoded by LINC02915 1.67e-02 3.19e-03 NA
2. P A2VDN0 Integral membrane protein 2C 8.22e-02 1.59e-04 NA
2. P B9GXD6 CASP-like protein 3A1 1.87e-03 1.10e-02 NA
2. P P36323 Envelope protein UL45 homolog NA 1.49e-04 NA
2. P Q5NVC3 Integral membrane protein 2C 6.62e-02 6.62e-04 NA
2. P C5XKI6 CASP-like protein 1E1 7.95e-03 2.95e-04 NA
2. P Q9Y287 Integral membrane protein 2B 2.33e-01 2.37e-03 NA
2. P Q9ZQI2 Casparian strip membrane protein 3 2.14e-03 1.52e-02 NA
2. P Q52N47 Integral membrane protein 2B NA 1.45e-02 NA
2. P Q91VK4 Integral membrane protein 2C 4.40e-02 5.21e-04 NA
2. P P28981 Envelope protein UL45 homolog NA 2.18e-05 NA
2. P P0DOU1 Protein L5 NA 3.13e-03 NA
2. P Q5PQL7 Integral membrane protein 2C 6.86e-02 3.93e-04 NA
2. P Q5R876 Integral membrane protein 2B 1.85e-01 2.37e-03 NA
2. P Q06AV4 Integral membrane protein 2C 2.34e-02 4.55e-04 NA
2. P P0C9K1 Protein MGF 110-13L NA 2.97e-02 NA
2. P Q4R540 Integral membrane protein 2C 6.89e-02 5.73e-05 NA
2. P O89051 Integral membrane protein 2B 6.45e-02 3.97e-03 NA
2. P Q9NQX7 Integral membrane protein 2C 9.01e-02 4.50e-04 NA
2. P Q6Z1Y7 Casparian strip membrane protein 2 2.02e-03 2.99e-02 NA
2. P G7IHF9 Casparian strip membrane protein 4 3.41e-03 1.06e-02 NA
2. P A2YQB8 Casparian strip membrane protein 2 5.06e-03 3.28e-02 NA
2. P Q5XIE8 Integral membrane protein 2B 5.75e-02 2.55e-04 NA
2. P Q3T0P7 Integral membrane protein 2B 6.19e-02 9.89e-04 NA
2. P P22598 Envelope protein UL45 homolog NA 4.64e-03 NA
2. P P0DOU2 Protein L5 NA 3.13e-03 NA