Summary

Q32NC0

Homolog: P40993.
Function: Ribonuclease MRP protein subunit SNM1.

Statistics

Total GO Annotation: 15
Unique PROST Go: 15
Unique BLAST Go: 0

Total Homologs: 19
Unique PROST Homologs: 14
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P40993 (Ribonuclease MRP protein subunit SNM1) with a FATCAT P-Value: 0.00052 and RMSD of 3.43 angstrom. The sequence alignment identity is 23.3%.
Structural alignment shown in left. Query protein Q32NC0 colored as red in alignment, homolog P40993 colored as blue. Query protein Q32NC0 is also shown in right top, homolog P40993 showed in right bottom. They are colored based on secondary structures. 

  Q32NC0 -------------MRQKHYLEAAARGLHDSCPG-QARYL--LWAYTSSHDD------------KS-TFEETCPYCFQLLVLDNSRVRLKPKARLTPKIQK 71
  P40993 MNKDQAEKYQERSLRQKYNL------LH-VLPTLNSRALSGLY-YKNFHNSVKRYQIMLPEQLKSGKF---CSHC-GCVYVPNFNASL----QLT----- 79

  Q32NC0 LLNREARNYT-LSFKEAKMVKKFKDSKSVLLITCKTCNRTVK-HHGKSRSFVSTLKSNPATPTSKLSLKTPERRTANPNHDMSGSKGK-SPASVFRTPTS 168
  P40993 -TNTEQGDSDELG-GES-M----EGPKKCIQVNCLNCEKS-KLFEWKSE-FV--------VPTFGQDV-SP---MIN-----STSSGKVSYA--VKKP-- 149

  Q32NC0 GQSVSTCSSKNTSKTKKHFSQLKMLLS-QNESQKIPK-----VDFRNFLSSLKGGLLK 220
  P40993 -QKSKTSTGKERSK-KRKLNSLTNLLSKRNQEKKMEKKKSSSLSLESFMKS------- 198

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0051607 defense response to virus
2. P GO:0006379 mRNA cleavage
2. P GO:0005655 nucleolar ribonuclease P complex
2. P GO:1905267 endonucleolytic cleavage involved in tRNA processing
2. P GO:0008270 zinc ion binding
2. P GO:0006612 protein targeting to membrane
2. P GO:0004518 nuclease activity
2. P GO:0030541 plasmid partitioning
2. P GO:0000172 ribonuclease MRP complex
2. P GO:0008033 tRNA processing
2. P GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0051205 protein insertion into membrane
2. P GO:0031849 olfactory receptor binding
2. P GO:0042134 rRNA primary transcript binding
2. P GO:0001580 detection of chemical stimulus involved in sensory perception of bitter taste

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q32NC0 UPF0711 protein C18orf21 0 4.07e-130 9.51e-163
1. PB Q05B49 UPF0711 protein C18orf21 homolog 1.48e-10 8.81e-76 4.16e-129
1. PB Q1LUS5 UPF0711 protein C18orf21 homolog 6.93e-07 8.13e-40 7.03e-20
1. PB Q4V7D8 UPF0711 protein C18orf21 homolog 1.13e-09 4.28e-61 8.19e-104
1. PB Q5XFZ0 UPF0711 protein C18orf21 homolog 9.44e-09 2.70e-56 6.01e-112
2. P Q290L7 UPF0587 protein GA18326 6.96e-01 5.96e-04 NA
2. P Q4V8D7 Protein FAM221A 8.41e-01 8.73e-03 NA
2. P O94306 Uncharacterized protein C16C4.19 2.84e-02 7.83e-08 NA
2. P Q9BQQ7 Receptor-transporting protein 3 1.94e-01 2.36e-04 NA
2. P Q96MD7 Uncharacterized protein C9orf85 5.71e-01 4.14e-02 NA
2. P Q9BI88 UPF0587 protein F46B6.12 6.21e-01 6.87e-04 NA
2. P P40993 Ribonuclease MRP protein subunit SNM1 5.20e-04 8.32e-04 NA
2. P A1Z9A2 UPF0587 protein CG4646 7.03e-01 1.36e-02 NA
2. P Q498R7 CXXC motif containing zinc binding protein 7.39e-01 2.48e-03 NA
2. P Q9NWV4 CXXC motif containing zinc binding protein 7.36e-01 3.13e-03 NA
2. P Q9ER80 Receptor-transporting protein 4 1.74e-01 3.07e-03 NA
2. P Q32P66 CXXC motif containing zinc binding protein 7.30e-01 2.90e-03 NA
2. P Q96DX8 Receptor-transporting protein 4 1.47e-01 1.57e-02 NA
2. P Q3B8G0 CXXC motif containing zinc binding protein 7.41e-01 3.46e-02 NA