Summary

Q3C1V1

Homolog: B5XBI1.
Function: Intraflagellar transport protein 43 homolog A.

Statistics

Total GO Annotation: 39
Unique PROST Go: 39
Unique BLAST Go: 0

Total Homologs: 17
Unique PROST Homologs: 14
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was B5XBI1 (Intraflagellar transport protein 43 homolog A) with a FATCAT P-Value: 0.025 and RMSD of 3.68 angstrom. The sequence alignment identity is 18.1%.
Structural alignment shown in left. Query protein Q3C1V1 colored as red in alignment, homolog B5XBI1 colored as blue. Query protein Q3C1V1 is also shown in right top, homolog B5XBI1 showed in right bottom. They are colored based on secondary structures. 

  Q3C1V1 MPKGRRGSHSPTMSQRSAPPLYFPSLYDRGISSSPLSDFNIWKKLFVPLKAG-GAPVGGAAGARSL--SQALPAPAP-------PPPPP---PGLGPSSE 87
  B5XBI1 --------------------------MDDNLQ---LGDSGVVKNV---AKLGRRARL-AAEQTSSLEESRHVRKSSSSTSMGEVPPPKPARRQG-G---- 62

  Q3C1V1 RPWPSPWPSGLASIPYEP----------LRFFYSP--PPGPEVVAS-PLVPCPS-------TPRLASASHPEELCELEIRI---KEL--ELL------TI 156
  B5XBI1 --W-AEETSGSAKSGRRPAVVEDVEDRRLR----PQTPQGSDDEGDIPVIPDLDEVQEEDLTMQVAA---PPSI-QVN-RVMTYRDLDNDLMKYSAFQTL 150

  Q3C1V1 TGDG-FDSQSYT-FL---KALKDEKLQG-----LKTK---------QPGKKSASLS---- 193
  B5XBI1 --DGEIDLKLLTKVLAPEQEVREEDV-GWDWDRLFTEVSSELLTEWDQGEKEEQVPLPVL 207

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0000082 G1/S transition of mitotic cell cycle
2. P GO:0090141 positive regulation of mitochondrial fission
2. P GO:0031491 nucleosome binding
2. P GO:0071479 cellular response to ionizing radiation
2. P GO:0090314 positive regulation of protein targeting to membrane
2. P GO:0000725 recombinational repair
2. P GO:0045892 negative regulation of transcription, DNA-templated
2. P GO:0016242 negative regulation of macroautophagy
2. P GO:0030331 estrogen receptor binding
2. P GO:0070318 positive regulation of G0 to G1 transition
2. P GO:0006626 protein targeting to mitochondrion
2. P GO:0048511 rhythmic process
2. P GO:0035721 intraciliary retrograde transport
2. P GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity
2. P GO:0009737 response to abscisic acid
2. P GO:0033148 positive regulation of intracellular estrogen receptor signaling pathway
2. P GO:0035067 negative regulation of histone acetylation
2. P GO:0030991 intraciliary transport particle A
2. P GO:0060271 cilium assembly
2. P GO:0042754 negative regulation of circadian rhythm
2. P GO:0010311 lateral root formation
2. P GO:0034644 cellular response to UV
2. P GO:0048367 shoot system development
2. P GO:0010608 posttranscriptional regulation of gene expression
2. P GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity
2. P GO:0005634 nucleus
2. P GO:0000266 mitochondrial fission
2. P GO:0045736 negative regulation of cyclin-dependent protein serine/threonine kinase activity
2. P GO:0048527 lateral root development
2. P GO:0019033 viral tegument
2. P GO:0005929 cilium
2. P GO:0060303 regulation of nucleosome density
2. P GO:0008021 synaptic vesicle
2. P GO:0000077 DNA damage checkpoint signaling
2. P GO:0048366 leaf development
2. P GO:0005730 nucleolus
2. P GO:0044177 host cell Golgi apparatus
2. P GO:0045740 positive regulation of DNA replication
2. P GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9D1Z2 Uncharacterized protein C11orf91 homolog 7.28e-04 2.05e-46 3.60e-81
1. PB A8WFF7 Uncharacterized protein C11orf91 homolog 2.20e-06 1.35e-48 1.76e-86
1. PB Q3C1V1 Uncharacterized protein C11orf91 0 3.99e-135 1.34e-133
2. P Q9C0C6 CLOCK-interacting pacemaker 2.74e-01 1.56e-02 NA
2. P Q8NEQ6 Steroid receptor-associated and regulated protein 4.42e-01 3.40e-02 NA
2. P Q7VKZ7 Der GTPase-activating protein YihI 1.80e-01 3.52e-02 NA
2. P Q9D9S1 UPF0193 protein EVG1 homolog 6.73e-02 1.49e-02 NA
2. P Q67Y93 Cyclin-dependent kinase inhibitor 1 4.59e-02 9.86e-05 NA
2. P Q8R0W1 CLOCK-interacting pacemaker 3.15e-01 2.91e-03 NA
2. P C5DFL1 Damage-regulated import facilitator 1 3.93e-01 2.01e-03 NA
2. P P38634 Protein SIC1 3.19e-01 3.49e-02 NA
2. P B5X7E4 Intraflagellar transport protein 43 homolog B 7.65e-02 8.52e-04 NA
2. P Q57Y88 PBP1-interacting protein XAC1 2.49e-01 4.19e-02 NA
2. P P30022 Tegument protein VP22 NA 1.47e-03 NA
2. P B5XBI1 Intraflagellar transport protein 43 homolog A 2.50e-02 2.80e-02 NA
2. P Q6DD53 Mitochondrial fission factor homolog A 3.66e-02 4.23e-02 NA
2. P Q9BSD3 RAD9, HUS1, RAD1-interacting nuclear orphan protein 1 3.35e-01 3.94e-02 NA