Summary

Q3MJ40

Homolog: Q6GNQ4.
Function: G kinase-anchoring protein 1-A.

Statistics

Total GO Annotation: 167
Unique PROST Go: 149
Unique BLAST Go: 18

Total Homologs: 111
Unique PROST Homologs: 85
Unique BLAST Homologs: 25

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q6GNQ4 (G kinase-anchoring protein 1-A) with a FATCAT P-Value: 0.00264 and RMSD of 3.20 angstrom. The sequence alignment identity is 17.9%.
Structural alignment shown in left. Query protein Q3MJ40 colored as red in alignment, homolog Q6GNQ4 colored as blue. Query protein Q3MJ40 is also shown in right top, homolog Q6GNQ4 showed in right bottom. They are colored based on secondary structures. 

  Q3MJ40 MASWGGEKRGGAEGSPKLAVYATRKTRSVRSQEDQWYLGYPGDQWSSGFSYSWWKNSVGSESKHGEGALDQPQHDVRLEDLGELHRAARSGDVPGVEHVL 100
  Q6GNQ4 ---------------------------------------------------------------------------------------------------- 0

  Q3MJ40 APGDTGVDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPDWHPTNLTLSDETCQRSKNLKVGDKSPSVSPSMPENQSATKELGQMNLTEREKMDTGVVLLS 200
  Q6GNQ4 -------------------------------------------------------------------------------------------MASAVV--- 6

  Q3MJ40 GNDTLHDLCQSQLPENKESKEAEQDLELTSEEEQERLKGCENKQPQKT-SQEPEMAKDCDREDIPIYPVLPHVQKSEEMWIEQGKLEWKNQLKLVINELK 299
  Q6GNQ4 ----------SMVP-TTASRFALLQVDSSSDSDSEKARGAHSS--GKAHSGSAARGKNKGNE-----------KKKEK---RRKK---KEQQQSEANELR 76

  Q3MJ40 Q-RFGEIYEKYKIPACPEEEPLLDNSTRGTDVKDIPFNLTNNIPG-CEEED-----ASEISVSVVFETFPEQKEPSL-KNIIHPYYHPYSGSQEHVCQSS 391
  Q6GNQ4 NLAF-----K-KIP--PKASP-------GVAVQE---HLTHTVPKVAQEEDWQQWQQRDVQL-----T-SDMYEADLEKALI-------------L---- 135

  Q3MJ40 SKLHLHENKLDCDNDNKLGIGHIFSTDNNFHNDASTKKARNPEVVTVEMKEDQEFDLQMTKNMNQNSDSGSTNNYKS--L--K--PKLENLSSLPPDSDR 485
  Q6GNQ4 SKLEFEESK---DNGN--G-------DNGVPQ---SKKV-N--------KKDKR------KN-NQGKDKPLTVPLKDFQLEDKHAKKQEELKS-PP---- 199

  Q3MJ40 TSEVYLHEELQQDMQKFKNEVNTLEEEFLALKKENVQLHKEVEEEMEKHRSNSTELSGT--------LTDGTTVGNDDDGLNQQIPRKENEEHDRPADKT 577
  Q6GNQ4 ---------LPQD-SGF---FNKLEED---VTK--IIL-KEKRKE---HSTDVTEQFATPEYSMEPVLKDGRT-----EVLKQEIEKKEVE--------- 263

  Q3MJ40 ANEKNKVKNQIYP-EADFADSMEPSEIASEDCELSHSVYENFMLLIEQLRM-EYKDSASLPRIQ-DTFCLCEHLLKLKNNHCDQLTVKLKQMENMVSVLQ 674
  Q6GNQ4 --LKQ-MKSIISQWEAKY------REVKA----------RNSQLL-KMLQEGEMKDKAEI-LLQVD------ELLSIKN----ELTLQVTTLH---AALE 329

  Q3MJ40 NELSETKKTKLQLELQKIEWE--KELYDLRLA-LKQENGRKEMPICCIIKIVNS 725
  Q6GNQ4 QERS---KVKI-LQAEQVKYQGGKK--SKRTAEL--EHGR-------------- 361

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0032886 regulation of microtubule-based process
2. P GO:0030374 nuclear receptor coactivator activity
2. P GO:0042994 cytoplasmic sequestering of transcription factor
2. P GO:0080115 myosin XI tail binding
2. P GO:0046965 retinoid X receptor binding
2. P GO:0043296 apical junction complex
2. P GO:0071539 protein localization to centrosome
2. P GO:0060438 trachea development
2. P GO:0008283 cell population proliferation
2. P GO:0007091 metaphase/anaphase transition of mitotic cell cycle
2. P GO:2000391 positive regulation of neutrophil extravasation
2. P GO:0005080 protein kinase C binding
2. P GO:0060450 positive regulation of hindgut contraction
2. P GO:0006281 DNA repair
2. P GO:0051285 cell cortex of cell tip
2. P GO:0061163 endoplasmic reticulum polarization
2. P GO:0090173 regulation of synaptonemal complex assembly
2. P GO:0071306 cellular response to vitamin E
2. P GO:0050860 negative regulation of T cell receptor signaling pathway
2. P GO:0048147 negative regulation of fibroblast proliferation
2. P GO:0090281 negative regulation of calcium ion import
2. P GO:0034451 centriolar satellite
2. P GO:1903238 positive regulation of leukocyte tethering or rolling
2. P GO:0051321 meiotic cell cycle
2. P GO:0039697 negative stranded viral RNA transcription
2. P GO:0097190 apoptotic signaling pathway
2. P GO:0001092 TFIIA-class transcription factor complex binding
2. P GO:0017108 5'-flap endonuclease activity
2. P GO:0007052 mitotic spindle organization
2. P GO:0008017 microtubule binding
2. P GO:0043194 axon initial segment
2. P GO:0042975 peroxisome proliferator activated receptor binding
2. P GO:0071963 establishment or maintenance of cell polarity regulating cell shape
2. P GO:0035259 glucocorticoid receptor binding
2. P GO:0051494 negative regulation of cytoskeleton organization
2. P GO:0007165 signal transduction
2. P GO:1904457 positive regulation of neuronal action potential
2. P GO:0007144 female meiosis I
2. P GO:0022027 interkinetic nuclear migration
2. P GO:1901082 positive regulation of relaxation of smooth muscle
2. P GO:0006310 DNA recombination
2. P GO:0036377 arbuscular mycorrhizal association
2. P GO:0007059 chromosome segregation
2. P GO:0005815 microtubule organizing center
2. P GO:0097575 lateral cell cortex
2. P GO:0098703 calcium ion import across plasma membrane
2. P GO:0051301 cell division
2. P GO:0042986 positive regulation of amyloid precursor protein biosynthetic process
2. P GO:1903068 positive regulation of protein localization to cell tip
2. P GO:0007283 spermatogenesis
2. P GO:0032516 positive regulation of phosphoprotein phosphatase activity
2. P GO:0000922 spindle pole
2. P GO:0051307 meiotic chromosome separation
2. P GO:0050965 detection of temperature stimulus involved in sensory perception of pain
2. P GO:0005790 smooth endoplasmic reticulum
2. P GO:0035332 positive regulation of hippo signaling
2. P GO:1902486 protein localization to growing cell tip
2. P GO:1902850 microtubule cytoskeleton organization involved in mitosis
2. P GO:0045760 positive regulation of action potential
2. P GO:0042130 negative regulation of T cell proliferation
2. P GO:0010719 negative regulation of epithelial to mesenchymal transition
2. P GO:0007431 salivary gland development
2. P GO:0033557 Slx1-Slx4 complex
2. P GO:0001578 microtubule bundle formation
2. P GO:0005694 chromosome
2. P GO:0006970 response to osmotic stress
2. P GO:0030950 establishment or maintenance of actin cytoskeleton polarity
2. P GO:0030889 negative regulation of B cell proliferation
2. P GO:0071787 endoplasmic reticulum tubular network formation
2. P GO:0007130 synaptonemal complex assembly
2. P GO:0045159 myosin II binding
2. P GO:0030864 cortical actin cytoskeleton
2. P GO:0060080 inhibitory postsynaptic potential
2. P GO:0060236 regulation of mitotic spindle organization
2. P GO:0005912 adherens junction
2. P GO:1902430 negative regulation of amyloid-beta formation
2. P GO:0051729 germline cell cycle switching, mitotic to meiotic cell cycle
2. P GO:0007015 actin filament organization
2. P GO:0071478 cellular response to radiation
2. P GO:0043522 leucine zipper domain binding
2. P GO:0051513 regulation of monopolar cell growth
2. P GO:1903394 protein localization to kinetochore involved in kinetochore assembly
2. P GO:0030953 astral microtubule organization
2. P GO:0007199 G protein-coupled receptor signaling pathway coupled to cGMP nucleotide second messenger
2. P GO:0030331 estrogen receptor binding
2. P GO:0071786 endoplasmic reticulum tubular network organization
2. P GO:0072686 mitotic spindle
2. P GO:0007141 male meiosis I
2. P GO:0042974 retinoic acid receptor binding
2. P GO:0006260 DNA replication
2. P GO:0043065 positive regulation of apoptotic process
2. P GO:0006302 double-strand break repair
2. P GO:0051310 metaphase plate congression
2. P GO:0097202 activation of cysteine-type endopeptidase activity
2. P GO:0030496 midbody
2. P GO:0000212 meiotic spindle organization
2. P GO:0005634 nucleus
2. P GO:1990918 double-strand break repair involved in meiotic recombination
2. P GO:0030476 ascospore wall assembly
2. P GO:0048255 mRNA stabilization
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0010629 negative regulation of gene expression
2. P GO:0022008 neurogenesis
2. P GO:0043525 positive regulation of neuron apoptotic process
2. P GO:0051382 kinetochore assembly
2. P GO:0005789 endoplasmic reticulum membrane
2. P GO:0035839 non-growing cell tip
2. P GO:0008157 protein phosphatase 1 binding
2. P GO:0016922 nuclear receptor binding
2. P GO:2000784 positive regulation of establishment of cell polarity regulating cell shape
2. P GO:0000785 chromatin
2. P GO:0010040 response to iron(II) ion
2. P GO:0019899 enzyme binding
2. P GO:0046966 thyroid hormone receptor binding
2. P GO:0035840 old growing cell tip
2. P GO:0051523 cell growth mode switching, monopolar to bipolar
2. P GO:0000775 chromosome, centromeric region
2. P GO:0007428 primary branching, open tracheal system
2. P GO:0046628 positive regulation of insulin receptor signaling pathway
2. P GO:0048599 oocyte development
2. P GO:0071372 cellular response to follicle-stimulating hormone stimulus
2. P GO:0005794 Golgi apparatus
2. P GO:0009649 entrainment of circadian clock
2. P GO:0061246 establishment or maintenance of bipolar cell polarity regulating cell shape
2. P GO:0007286 spermatid development
2. P GO:0000278 mitotic cell cycle
2. P GO:0021987 cerebral cortex development
2. P GO:0050966 detection of mechanical stimulus involved in sensory perception of pain
2. P GO:0042754 negative regulation of circadian rhythm
2. P GO:0070192 chromosome organization involved in meiotic cell cycle
2. P GO:0051276 chromosome organization
2. P GO:0006915 apoptotic process
2. P GO:0010628 positive regulation of gene expression
2. P GO:0051017 actin filament bundle assembly
2. P GO:0000940 outer kinetochore
2. P GO:0015630 microtubule cytoskeleton
2. P GO:1901300 positive regulation of hydrogen peroxide-mediated programmed cell death
2. P GO:0035371 microtubule plus-end
2. P GO:0003779 actin binding
2. P GO:1903067 negative regulation of protein localization to cell tip
2. P GO:0043060 meiotic metaphase I plate congression
2. P GO:0000139 Golgi membrane
2. P GO:0043666 regulation of phosphoprotein phosphatase activity
2. P GO:0000164 protein phosphatase type 1 complex
2. P GO:0000776 kinetochore
2. P GO:0008093 cytoskeletal anchor activity
2. P GO:0097248 maintenance of protein location in cell cortex of cell tip
2. P GO:1905342 positive regulation of protein localization to kinetochore
2. P GO:2000774 positive regulation of cellular senescence
3. B GO:0001895 retina homeostasis
3. B GO:0046627 negative regulation of insulin receptor signaling pathway
3. B GO:0070373 negative regulation of ERK1 and ERK2 cascade
3. B GO:0005813 centrosome
3. B GO:0040015 negative regulation of multicellular organism growth
3. B GO:0046621 negative regulation of organ growth
3. B GO:0015629 actin cytoskeleton
3. B GO:0070062 extracellular exosome
3. B GO:0045599 negative regulation of fat cell differentiation
3. B GO:0019217 regulation of fatty acid metabolic process
3. B GO:0008200 ion channel inhibitor activity
3. B GO:0019216 regulation of lipid metabolic process
3. B GO:0060259 regulation of feeding behavior
3. B GO:0072562 blood microparticle
3. B GO:0005615 extracellular space
3. B GO:0042593 glucose homeostasis
3. B GO:0021762 substantia nigra development
3. B GO:0005938 cell cortex

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q3MJ40 Coiled-coil domain-containing protein 144B 0 9.07e-164 0.0
2. P Q5XIG5 G kinase-anchoring protein 1 2.62e-02 3.37e-04 NA
2. P Q3USH1 Inhibitory synaptic factor 2A 4.51e-01 3.23e-04 NA
2. P F4HSD5 Protein TRM32 1.18e-01 9.57e-03 NA
2. P Q1RMS0 Serine-rich coiled-coil domain-containing protein 1 1.85e-01 5.45e-10 NA
2. P Q9PTG8 Transforming acidic coiled-coil-containing protein 3 6.28e-02 1.81e-04 NA
2. P Q6GQV1 INSYN2B protein 2.95e-01 9.89e-06 NA
2. P Q64548 Reticulon-1 1.31e-01 3.17e-03 NA
2. P Q9VH89 Protein dalmatian 2.18e-01 1.18e-04 NA
2. P Q6RJR6 Reticulon-3 3.55e-02 1.20e-04 NA
2. P A2RUB1 Meiosis-specific coiled-coil domain-containing protein MEIOC 1.99e-01 8.91e-03 NA
2. P Q5VUR7 Putative ankyrin repeat domain-containing protein 20A3 6.43e-03 3.79e-03 NA
2. P Q5VSY0 G kinase-anchoring protein 1 3.27e-03 1.93e-05 NA
2. P Q16799 Reticulon-1 1.56e-01 1.87e-04 NA
2. P F4INW9 Probable myosin-binding protein 4 1.65e-02 7.84e-06 NA
2. P Q9Y3Q8 TSC22 domain family protein 4 1.14e-01 8.91e-03 NA
2. P Q9JMB0 G kinase-anchoring protein 1 1.96e-02 3.18e-05 NA
2. P P87299 Meiotically up-regulated gene 74 protein 6.74e-02 1.31e-02 NA
2. P Q6GNQ4 G kinase-anchoring protein 1-A 2.64e-03 2.60e-04 NA
2. P A8MQN2 Protein LNK1 4.30e-01 4.80e-02 NA
2. P C1GAZ3 Structure-specific endonuclease subunit SLX4 3.85e-01 1.09e-02 NA
2. P Q4UJ75 Putative ankyrin repeat domain-containing protein 20A4 7.55e-03 1.15e-02 NA
2. P B9G5N1 Meiosis-specific protein PAIR3 2.03e-01 2.79e-04 NA
2. P Q561R1 Centromere protein T 2.99e-01 1.26e-02 NA
2. P F4HXQ7 Myosin-binding protein 1 5.82e-02 1.59e-02 NA
2. P Q922C1 Uncharacterized protein C19orf44 homolog 7.64e-02 2.96e-02 NA
2. P A9XMT3 Protein CYCLOPS 2.34e-01 6.53e-03 NA
2. P A8MVM7 Putative uncharacterized protein ENSP00000382790 3.38e-01 4.35e-02 NA
2. P Q2KHM9 Protein moonraker 3.19e-01 2.29e-02 NA
2. P Q6DIA7 Break repair meiotic recombinase recruitment factor 1 1.07e-01 2.32e-06 NA
2. P Q0WR66 Meiosis-specific protein ASY3 2.26e-02 9.59e-10 NA
2. P Q5SQ80 Putative ankyrin repeat domain-containing protein 20A2 2.07e-02 4.44e-03 NA
2. P Q96IZ0 PRKC apoptosis WT1 regulator protein 4.59e-02 3.50e-02 NA
2. P Q9EQN3 TSC22 domain family protein 4 2.89e-01 2.79e-02 NA
2. P Q751A7 Protein ATC1/LIC4 2.36e-02 6.81e-04 NA
2. P Q9Y6A5 Transforming acidic coiled-coil-containing protein 3 5.48e-02 1.28e-07 NA
2. P Q75K81 Zinc finger CCCH domain-containing protein 36 2.20e-01 3.72e-02 NA
2. P Q5MY90 Reticulon-1-B 4.61e-02 1.20e-03 NA
2. P Q2U6E8 Structure-specific endonuclease subunit slx4 3.40e-01 1.88e-03 NA
2. P Q0V640 Structure-specific endonuclease subunit SLX4 5.60e-01 1.31e-02 NA
2. P A6NMK8 Protein INSYN2B 2.25e-01 3.54e-02 NA
2. P A7MC64 Reticulon-1 5.56e-02 2.79e-05 NA
2. P Q5M8L3 G kinase-anchoring protein 1 1.85e-02 2.59e-03 NA
2. P Q5SX79 Protein Shroom1 2.90e-02 8.86e-06 NA
2. P Q9JJ11 Transforming acidic coiled-coil-containing protein 3 3.76e-02 1.46e-03 NA
2. P P38229 GLC7-interacting protein 1 2.61e-01 1.10e-02 NA
2. P Q6Y685 Transforming acidic coiled-coil-containing protein 1 1.00e-01 2.05e-09 NA
2. P Q09560 Uncharacterized protein F36G3.1 3.48e-02 1.31e-05 NA
2. P Q9H6X5 Uncharacterized protein C19orf44 1.08e-01 1.05e-03 NA
2. P O60132 Tip elongation aberrant protein Tea4 2.27e-01 3.65e-02 NA
2. P Q32LE2 G kinase-anchoring protein 1 7.50e-03 5.14e-03 NA
2. P Q3UHI0 Serine-rich coiled-coil domain-containing protein 2 9.86e-02 2.26e-02 NA
2. P Q9H7U1 Serine-rich coiled-coil domain-containing protein 2 2.50e-01 7.79e-03 NA
2. P B8MED8 Structure-specific endonuclease subunit slx4 2.98e-01 2.31e-05 NA
2. P Q5TYW2 Ankyrin repeat domain-containing protein 20A1 4.90e-03 4.00e-03 NA
2. P Q5IS59 Reticulon-1 6.80e-02 1.51e-04 NA
2. P Q80VM7 Ankyrin repeat domain-containing protein 24 1.84e-01 4.47e-04 NA
2. P Q8N283 Ankyrin repeat domain-containing protein 35 8.79e-02 1.38e-02 NA
2. P Q8K0T0 Reticulon-1 1.61e-01 1.77e-04 NA
2. P C0NBH5 Structure-specific endonuclease subunit SLX4 2.07e-01 4.89e-02 NA
2. P B6HBG5 Structure-specific endonuclease subunit slx4 1.84e-01 8.12e-03 NA
2. P Q9LF24 Protein LONGIFOLIA 1 3.48e-01 2.03e-02 NA
2. P O14273 Meiotically up-regulated protein C8C9.04 3.04e-01 3.99e-05 NA
2. P Q62627 PRKC apoptosis WT1 regulator protein 6.81e-02 2.07e-02 NA
2. P Q6FSM8 Protein FYV8 5.93e-02 3.11e-05 NA
2. P P0CB21 Uncharacterized protein At4g26450 1.17e-01 1.05e-03 NA
2. P P47825 Transcription initiation factor TFIID subunit 4 1.22e-01 1.03e-02 NA
2. P Q9ES97 Reticulon-3 1.93e-01 6.30e-04 NA
2. P Q2M3G4 Protein Shroom1 6.84e-02 7.47e-07 NA
2. P Q5CZ79 Ankyrin repeat domain-containing protein 20B 5.53e-02 2.88e-03 NA
2. P B3KU38 IQCJ-SCHIP1 readthrough transcript protein 4.10e-02 3.40e-02 NA
2. P Q8R0W1 CLOCK-interacting pacemaker 1.51e-01 8.73e-03 NA
2. P Q3TJM4 Centromere protein T 1.18e-01 7.79e-03 NA
2. P P46949 Protein FYV8 1.31e-01 4.08e-04 NA
2. P P39523 Uncharacterized protein YMR124W 1.55e-01 9.30e-06 NA
2. P A2AG06 Meiosis-specific coiled-coil domain-containing protein MEIOC 2.32e-01 4.61e-02 NA
2. P Q6AXP1 Uncharacterized protein C19orf44 homolog 3.71e-01 6.62e-05 NA
2. P O75410 Transforming acidic coiled-coil-containing protein 1 2.54e-01 1.85e-11 NA
2. P Q9UT17 Uncharacterized protein C9.11 8.95e-02 3.75e-02 NA
2. P Q925B0 PRKC apoptosis WT1 regulator protein 1.80e-02 1.24e-02 NA
2. P Q75C80 Protein FYV8 2.44e-02 7.35e-05 NA
2. P P34278 Kinetochore null protein 1 9.96e-02 7.37e-06 NA
2. P Q9IK91 Phosphoprotein NA 1.63e-03 NA
2. P Q8AVX1 G kinase-anchoring protein 1-B 5.20e-02 2.30e-03 NA
2. P Q0VDD7 Break repair meiotic recombinase recruitment factor 1 1.11e-01 9.07e-04 NA
2. P B8NLN6 Structure-specific endonuclease subunit slx4 3.09e-01 2.94e-03 NA
3. B A5A3E0 POTE ankyrin domain family member F 9.06e-01 NA 1.06e-08
3. B Q6NUI1 Putative coiled-coil domain-containing protein 144 N-terminal-like 1.39e-01 NA 3.43e-76
3. B Q6S8J7 POTE ankyrin domain family member A 1.81e-01 NA 1.76e-33
3. B A6NC57 Ankyrin repeat domain-containing protein 62 1.49e-02 NA 3.06e-27
3. B Q811D2 Ankyrin repeat domain-containing protein 26 5.60e-01 NA 4.45e-23
3. B Q6S5H5 POTE ankyrin domain family member G 6.88e-01 NA 1.13e-05
3. B Q9BXX2 Ankyrin repeat domain-containing protein 30B 4.17e-01 NA 1.58e-11
3. B Q6S545 POTE ankyrin domain family member H 5.69e-01 NA 1.31e-05
3. B A2RUR9 Coiled-coil domain-containing protein 144A 3.25e-02 NA 0.0
3. B A6NI47 Putative POTE ankyrin domain family member M 3.36e-01 NA 1.07e-05
3. B Q6S8J3 POTE ankyrin domain family member E 4.57e-01 NA 1.20e-08
3. B Q9UPS8 Ankyrin repeat domain-containing protein 26 4.09e-01 NA 1.72e-43
3. B Q5JPF3 Ankyrin repeat domain-containing protein 36C 5.48e-01 NA 2.63e-23
3. B Q8IYA2 Putative coiled-coil domain-containing protein 144C 1.27e-02 NA 0.0
3. B Q9BXX3 Ankyrin repeat domain-containing protein 30A 4.75e-01 NA 7.55e-10
3. B P0CG39 POTE ankyrin domain family member J 5.30e-01 NA 1.92e-09
3. B B2RU33 POTE ankyrin domain family member C 1.39e-01 NA 1.08e-07
3. B A6QL64 Ankyrin repeat domain-containing protein 36A 3.92e-01 NA 1.62e-22
3. B H3BUK9 POTE ankyrin domain family member B2 5.62e-02 NA 1.23e-07
3. B Q8N2N9 Ankyrin repeat domain-containing protein 36B 2.11e-01 NA 2.78e-22
3. B Q6NSI1 Putative ankyrin repeat domain-containing protein 26-like protein 4.16e-01 NA 0.009
3. B P0CG38 POTE ankyrin domain family member I 4.91e-01 NA 2.21e-09
3. B A0JP26 POTE ankyrin domain family member B3 3.15e-01 NA 1.34e-07
3. B Q86YR6 POTE ankyrin domain family member D 1.88e-02 NA 1.36e-07
3. B A0A0A6YYL3 POTE ankyrin domain family member B 1.36e-02 NA 1.23e-07