Summary

Q3SY05

Homolog: O60756.
Function: Putative protein BCE-1.

Statistics

Total GO Annotation: 4
Unique PROST Go: 4
Unique BLAST Go: 0

Total Homologs: 16
Unique PROST Homologs: 15
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was O60756 (Putative protein BCE-1) with a FATCAT P-Value: 0.00444 and RMSD of 1.54 angstrom. The sequence alignment identity is 17.9%.
Structural alignment shown in left. Query protein Q3SY05 colored as red in alignment, homolog O60756 colored as blue. Query protein Q3SY05 is also shown in right top, homolog O60756 showed in right bottom. They are colored based on secondary structures. 

  Q3SY05 MYKSWTLG-DPKEKEGVGNILEETKRTQNNTEQASRAINSPLQSPYTDSMK-ALAISSH-WFLPQIHTLPPITKATRHRWPPAC-CGRRGGQTTLP--PL 94
  O60756 ------MGRTPTAVQ-VKSF---TK--QGQQRRVCRDL--PLKN--T---KNGLSPGMRTCFL-YLRFFPCLSWMSL-KWTQAVHCAR---NIVLSFMLL 76

  Q3SY05 TPIVRACESMERSCPGNYPMQHERKVMQRHPTLR 128
  O60756 LLLL------------NYNM-------------- 84

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0042025 host cell nucleus
2. P GO:0030430 host cell cytoplasm
2. P GO:0039592 suppression by virus of G2/M transition of host mitotic cell cycle
2. P GO:0072686 mitotic spindle

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q3SY05 Putative uncharacterized protein encoded by LINC00303 0 1.03e-139 2.71e-93
2. P Q2T9X5 Uncharacterized protein C7orf61 homolog 1.07e-02 5.77e-04 NA
2. P P06925 Probable protein E4 NA 2.32e-03 NA
2. P P06926 Protein E4 NA 1.30e-02 NA
2. P A0A023PZL7 Putative uncharacterized protein YMR294W-A 4.25e-03 6.51e-03 NA
2. P P53138 Putative uncharacterized protein YGL109W 4.70e-01 1.34e-03 NA
2. P P38275 Putative uncharacterized protein YBR134W 6.90e-01 2.00e-02 NA
2. P P58512 Uncharacterized protein encoded by LINC01547 8.87e-01 3.56e-02 NA
2. P P03290 Uncharacterized protein E-115 NA 1.30e-02 NA
2. P P87318 Uncharacterized protein C31F10.17c 5.08e-01 5.09e-04 NA
2. P P0DSO1 Protein FAM246C 9.92e-02 6.40e-04 NA
2. P P38194 Uncharacterized protein YBL044W 1.92e-02 3.04e-02 NA
2. P Q86TA4 Putative uncharacterized protein FLJ44553 2.91e-01 7.04e-03 NA
2. P P47162 Uncharacterized protein YJR128W 8.12e-01 2.32e-04 NA
2. P O60756 Putative protein BCE-1 4.44e-03 3.25e-02 NA
2. P P11301 Probable protein E4 NA 2.78e-06 NA