Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
O60756
(Putative protein BCE-1) with a FATCAT P-Value: 0.00444 and RMSD of 1.54 angstrom. The sequence alignment identity is 17.9%.
Structural alignment shown in left. Query protein Q3SY05 colored as red in alignment, homolog O60756 colored as blue.
Query protein Q3SY05 is also shown in right top, homolog O60756 showed in right bottom. They are colored based on secondary structures.
Q3SY05 MYKSWTLG-DPKEKEGVGNILEETKRTQNNTEQASRAINSPLQSPYTDSMK-ALAISSH-WFLPQIHTLPPITKATRHRWPPAC-CGRRGGQTTLP--PL 94 O60756 ------MGRTPTAVQ-VKSF---TK--QGQQRRVCRDL--PLKN--T---KNGLSPGMRTCFL-YLRFFPCLSWMSL-KWTQAVHCAR---NIVLSFMLL 76 Q3SY05 TPIVRACESMERSCPGNYPMQHERKVMQRHPTLR 128 O60756 LLLL------------NYNM-------------- 84
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0042025 | host cell nucleus |
| 2. P | GO:0030430 | host cell cytoplasm |
| 2. P | GO:0039592 | suppression by virus of G2/M transition of host mitotic cell cycle |
| 2. P | GO:0072686 | mitotic spindle |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q3SY05 | Putative uncharacterized protein encoded by LINC00303 | 0 | 1.03e-139 | 2.71e-93 |
| 2. P | Q2T9X5 | Uncharacterized protein C7orf61 homolog | 1.07e-02 | 5.77e-04 | NA |
| 2. P | P06925 | Probable protein E4 | NA | 2.32e-03 | NA |
| 2. P | P06926 | Protein E4 | NA | 1.30e-02 | NA |
| 2. P | A0A023PZL7 | Putative uncharacterized protein YMR294W-A | 4.25e-03 | 6.51e-03 | NA |
| 2. P | P53138 | Putative uncharacterized protein YGL109W | 4.70e-01 | 1.34e-03 | NA |
| 2. P | P38275 | Putative uncharacterized protein YBR134W | 6.90e-01 | 2.00e-02 | NA |
| 2. P | P58512 | Uncharacterized protein encoded by LINC01547 | 8.87e-01 | 3.56e-02 | NA |
| 2. P | P03290 | Uncharacterized protein E-115 | NA | 1.30e-02 | NA |
| 2. P | P87318 | Uncharacterized protein C31F10.17c | 5.08e-01 | 5.09e-04 | NA |
| 2. P | P0DSO1 | Protein FAM246C | 9.92e-02 | 6.40e-04 | NA |
| 2. P | P38194 | Uncharacterized protein YBL044W | 1.92e-02 | 3.04e-02 | NA |
| 2. P | Q86TA4 | Putative uncharacterized protein FLJ44553 | 2.91e-01 | 7.04e-03 | NA |
| 2. P | P47162 | Uncharacterized protein YJR128W | 8.12e-01 | 2.32e-04 | NA |
| 2. P | O60756 | Putative protein BCE-1 | 4.44e-03 | 3.25e-02 | NA |
| 2. P | P11301 | Probable protein E4 | NA | 2.78e-06 | NA |