Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
F1QEG2
(Kelch-like protein 41b) with a FATCAT P-Value: 0.0 and RMSD of 3.37 angstrom. The sequence alignment identity is 28.7%.
Structural alignment shown in left. Query protein Q3ZCT8 colored as red in alignment, homolog F1QEG2 colored as blue.
Query protein Q3ZCT8 is also shown in right top, homolog F1QEG2 showed in right bottom. They are colored based on secondary structures.
Q3ZCT8 MECK-IEGKEK---YQHSLNLLNKIQNMKELA---EMIDVVLTAEGEK-FPCHRLVLAAFSPYFKAMFTC--GLLECN-QREVILYDITAESVSVLLNYM 89 F1QEG2 MDPKAI--KEELRLFQST--LLQ--DGLKELLNENKFVDCTLKI-GDRCFPCHRLIMAACSPYFRELFFSEDG-KEKDIGKEVVLDDVDPNIMDMILQYL 92 Q3ZCT8 YNAALEINNANVQ-TVAMAAYFMQMEEVFSVCQKYMMDHMDASNC-----LGIYYFAKQ--IGAED-LSDRSKKYLYQHFAEVSLHEEILEIEVHQFLTL 180 F1QEG2 YSAEIDLVDDNVQEIFAVANRF-QIPSVFTVCVNYLQQKLSMANCLAVFRLGLVLSVPRLAIAARDFIADR--------FETVSSEEEFLQLAPHELLAL 183 Q3ZCT8 IKSDDLNISREESILDLVLRWVNHNKELRTVHLVELLKQVRLELVNP-SFLRQALRRNTMLLCDADC---VDIIQNAFKA-I--KTPQQHS---LNLRYG 270 F1QEG2 IGGDMLNVEKEEVVFESVMKWVRNDKANRVKSLAEAFDCIRFRLL-PEKYFREKVETDDIIKGDPELLKKLQLVKDAFKGKLPEKKPKEKKEGEVN---G 279 Q3ZCT8 METTSLLLCIG--N-NSS-GIRSRHRSYG-D--------ASFCYDPVSRKTYFISS-----PKYGEGLGTVCTGVVMENNTIIVAG----EASASKLSRQ 348 F1QEG2 EEEGEEML-PGFLNDNRRLGM------YGRDLIVMINDTAAVAYDVVENEC-FLAAMAEQVPK--NHV-SLCT---KKNQLFIVGGLFVDEES------- 358 Q3ZCT8 KNKNVEIYRYH-DRGNQFWEKL-------CTAEFRELYALGSIHNDLYVIGGQMKIK-NQYLIT-NCVDKYSVERDNWKRVSPLPLQLACHAVVTVNNKL 438 F1QEG2 KESPLQCYFYQLDSFSSDWRALPPMPSPRC------LFNLGESENLLFAIAGK-DLQTNESLDSVMCFD---TERMKWSETKKLPLHIHGHSVVSHNNLV 448 Q3ZCT8 YVIGGWTPQMDLPDEEPDRLSNKLLQYDPSQDQWSVRAPMKYSKYRFSTAVVN-SEIYVLGGIGCVGQDKGQVRKCLDVVEIYNPDGDFWREG-PPMPSP 536 F1QEG2 YCIGGKT---D--DNKA--LS-KMFVYNHKQSEWRELASMKTPRAMFG-AVVHKGKIIVTGG---VNED-G-L-TALS--ETYDFDTNKW-DTFTEFPQE 530 Q3ZCT8 LLSLRTNSTNAGAVDGKLYVCGGF---HGADRHEVISKEILELDPW---ENQ--WNVVAINVL--M-HDSYDVCL-----VARMNPRDLIPPPSDLVEEG 620 F1QEG2 RSSV--NLVSSG---GNLFSIGGFAIVELEDKN-IGPSEI--TDIWQYEEDKKTWS----GMLREMRYASGSSCVGMRLNAARM-PK-L----------- 605 Q3ZCT8 NEH 623 F1QEG2 --- 605
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0045604 | regulation of epidermal cell differentiation |
| 1. PB | GO:0016055 | Wnt signaling pathway |
| 1. PB | GO:0071466 | cellular response to xenobiotic stimulus |
| 1. PB | GO:0032886 | regulation of microtubule-based process |
| 1. PB | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 1. PB | GO:0048873 | homeostasis of number of cells within a tissue |
| 1. PB | GO:0045886 | negative regulation of synaptic assembly at neuromuscular junction |
| 1. PB | GO:0042994 | cytoplasmic sequestering of transcription factor |
| 1. PB | GO:0072156 | distal tubule morphogenesis |
| 1. PB | GO:0031398 | positive regulation of protein ubiquitination |
| 1. PB | GO:0031463 | Cul3-RING ubiquitin ligase complex |
| 1. PB | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0071353 | cellular response to interleukin-4 |
| 1. PB | GO:0035020 | regulation of Rac protein signal transduction |
| 1. PB | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0034451 | centriolar satellite |
| 1. PB | GO:0045109 | intermediate filament organization |
| 1. PB | GO:0050951 | sensory perception of temperature stimulus |
| 1. PB | GO:0001701 | in utero embryonic development |
| 1. PB | GO:0045171 | intercellular bridge |
| 1. PB | GO:0016567 | protein ubiquitination |
| 1. PB | GO:0031430 | M band |
| 1. PB | GO:0070294 | renal sodium ion absorption |
| 1. PB | GO:0032435 | negative regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0031672 | A band |
| 1. PB | GO:0014032 | neural crest cell development |
| 1. PB | GO:0045214 | sarcomere organization |
| 1. PB | GO:0008344 | adult locomotory behavior |
| 1. PB | GO:0004842 | ubiquitin-protein transferase activity |
| 1. PB | GO:0006888 | endoplasmic reticulum to Golgi vesicle-mediated transport |
| 1. PB | GO:0014029 | neural crest formation |
| 1. PB | GO:0031275 | obsolete regulation of lateral pseudopodium assembly |
| 1. PB | GO:0071233 | cellular response to leucine |
| 1. PB | GO:0002467 | germinal center formation |
| 1. PB | GO:0043066 | negative regulation of apoptotic process |
| 1. PB | GO:0001726 | ruffle |
| 1. PB | GO:0006513 | protein monoubiquitination |
| 1. PB | GO:0032465 | regulation of cytokinesis |
| 1. PB | GO:0032839 | dendrite cytoplasm |
| 1. PB | GO:0007420 | brain development |
| 1. PB | GO:0005884 | actin filament |
| 1. PB | GO:2000291 | regulation of myoblast proliferation |
| 1. PB | GO:0010507 | negative regulation of autophagy |
| 1. PB | GO:0030036 | actin cytoskeleton organization |
| 1. PB | GO:0039648 | modulation by virus of host protein ubiquitination |
| 1. PB | GO:0016605 | PML body |
| 1. PB | GO:0030057 | desmosome |
| 1. PB | GO:0019964 | interferon-gamma binding |
| 1. PB | GO:0042428 | serotonin metabolic process |
| 1. PB | GO:0005802 | trans-Golgi network |
| 1. PB | GO:0043025 | neuronal cell body |
| 1. PB | GO:2001014 | regulation of skeletal muscle cell differentiation |
| 1. PB | GO:0016235 | aggresome |
| 1. PB | GO:0048808 | male genitalia morphogenesis |
| 1. PB | GO:0060586 | multicellular organismal iron ion homeostasis |
| 1. PB | GO:0005886 | plasma membrane |
| 1. PB | GO:0071322 | cellular response to carbohydrate stimulus |
| 1. PB | GO:0010506 | regulation of autophagy |
| 1. PB | GO:0097718 | disordered domain specific binding |
| 1. PB | GO:0050801 | ion homeostasis |
| 1. PB | GO:1904263 | positive regulation of TORC1 signaling |
| 1. PB | GO:0071630 | nuclear protein quality control by the ubiquitin-proteasome system |
| 1. PB | GO:0005856 | cytoskeleton |
| 1. PB | GO:0039649 | modulation by virus of host ubiquitin-protein ligase activity |
| 1. PB | GO:0034599 | cellular response to oxidative stress |
| 1. PB | GO:0097602 | cullin family protein binding |
| 1. PB | GO:0035914 | skeletal muscle cell differentiation |
| 1. PB | GO:0005912 | adherens junction |
| 1. PB | GO:0098528 | skeletal muscle fiber differentiation |
| 1. PB | GO:1990390 | protein K33-linked ubiquitination |
| 1. PB | GO:0006446 | regulation of translational initiation |
| 1. PB | GO:0021680 | cerebellar Purkinje cell layer development |
| 1. PB | GO:0016234 | inclusion body |
| 1. PB | GO:2001243 | negative regulation of intrinsic apoptotic signaling pathway |
| 1. PB | GO:0014728 | regulation of the force of skeletal muscle contraction |
| 1. PB | GO:0030239 | myofibril assembly |
| 1. PB | GO:0030430 | host cell cytoplasm |
| 1. PB | GO:0015629 | actin cytoskeleton |
| 1. PB | GO:0061061 | muscle structure development |
| 1. PB | GO:0050804 | modulation of chemical synaptic transmission |
| 1. PB | GO:0031674 | I band |
| 1. PB | GO:0005819 | spindle |
| 1. PB | GO:0048741 | skeletal muscle fiber development |
| 1. PB | GO:0051865 | protein autoubiquitination |
| 1. PB | GO:0048208 | COPII vesicle coating |
| 1. PB | GO:0072686 | mitotic spindle |
| 1. PB | GO:0042748 | circadian sleep/wake cycle, non-REM sleep |
| 1. PB | GO:0031397 | negative regulation of protein ubiquitination |
| 1. PB | GO:0030134 | COPII-coated ER to Golgi transport vesicle |
| 1. PB | GO:0033150 | cytoskeletal calyx |
| 1. PB | GO:0030496 | midbody |
| 1. PB | GO:0031208 | POZ domain binding |
| 1. PB | GO:1901992 | positive regulation of mitotic cell cycle phase transition |
| 1. PB | GO:0005827 | polar microtubule |
| 1. PB | GO:0006895 | Golgi to endosome transport |
| 1. PB | GO:0048512 | circadian behavior |
| 1. PB | GO:0045661 | regulation of myoblast differentiation |
| 1. PB | GO:0000070 | mitotic sister chromatid segregation |
| 1. PB | GO:0042803 | protein homodimerization activity |
| 1. PB | GO:0035853 | chromosome passenger complex localization to spindle midzone |
| 1. PB | GO:0036268 | swimming |
| 1. PB | GO:0051015 | actin filament binding |
| 1. PB | GO:0030127 | COPII vesicle coat |
| 1. PB | GO:1900242 | regulation of synaptic vesicle endocytosis |
| 1. PB | GO:2000312 | regulation of kainate selective glutamate receptor activity |
| 1. PB | GO:0070936 | protein K48-linked ubiquitination |
| 1. PB | GO:0016021 | integral component of membrane |
| 1. PB | GO:0031143 | pseudopodium |
| 1. PB | GO:0033017 | sarcoplasmic reticulum membrane |
| 1. PB | GO:0015630 | microtubule cytoskeleton |
| 1. PB | GO:0005829 | cytosol |
| 1. PB | GO:0009566 | fertilization |
| 1. PB | GO:0046872 | metal ion binding |
| 1. PB | GO:0071889 | 14-3-3 protein binding |
| 1. PB | GO:0007616 | long-term memory |
| 1. PB | GO:0003779 | actin binding |
| 1. PB | GO:0001933 | negative regulation of protein phosphorylation |
| 1. PB | GO:0071379 | cellular response to prostaglandin stimulus |
| 1. PB | GO:2000042 | negative regulation of double-strand break repair via homologous recombination |
| 1. PB | GO:0090076 | relaxation of skeletal muscle |
| 1. PB | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0030307 | positive regulation of cell growth |
| 1. PB | GO:0042802 | identical protein binding |
| 1. PB | GO:0008584 | male gonad development |
| 1. PB | GO:0005654 | nucleoplasm |
| 2. P | GO:0061912 | selective autophagy |
| 2. P | GO:0048471 | perinuclear region of cytoplasm |
| 2. P | GO:0120197 | mucociliary clearance |
| 2. P | GO:1904672 | regulation of somatic stem cell population maintenance |
| 2. P | GO:0051301 | cell division |
| 2. P | GO:0035455 | response to interferon-alpha |
| 2. P | GO:0097066 | response to thyroid hormone |
| 2. P | GO:0060090 | molecular adaptor activity |
| 2. P | GO:0016358 | dendrite development |
| 2. P | GO:0006941 | striated muscle contraction |
| 2. P | GO:0001887 | selenium compound metabolic process |
| 2. P | GO:0005764 | lysosome |
| 2. P | GO:0043966 | histone H3 acetylation |
| 2. P | GO:0007286 | spermatid development |
| 2. P | GO:0030424 | axon |
| 2. P | GO:0010499 | proteasomal ubiquitin-independent protein catabolic process |
| 2. P | GO:0030027 | lamellipodium |
| 2. P | GO:1990716 | axonemal central apparatus |
| 2. P | GO:0060028 | convergent extension involved in axis elongation |
| 2. P | GO:0071230 | cellular response to amino acid stimulus |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0030425 | dendrite |
| 2. P | GO:0047485 | protein N-terminus binding |
| 2. P | GO:0036464 | cytoplasmic ribonucleoprotein granule |
| 2. P | GO:0009968 | negative regulation of signal transduction |
| 2. P | GO:0014069 | postsynaptic density |
| 2. P | GO:0046329 | negative regulation of JNK cascade |
| 2. P | GO:0050853 | B cell receptor signaling pathway |
| 2. P | GO:0007049 | cell cycle |
| 2. P | GO:0007010 | cytoskeleton organization |
| 2. P | GO:0007628 | adult walking behavior |
| 2. P | GO:0030914 | |
| 2. P | GO:0033276 | transcription factor TFTC complex |
| 3. B | GO:0001227 | DNA-binding transcription repressor activity, RNA polymerase II-specific |
| 3. B | GO:0000976 | transcription cis-regulatory region binding |
| 3. B | GO:0070530 | K63-linked polyubiquitin modification-dependent protein binding |
| 3. B | GO:0097237 | cellular response to toxic substance |
| 3. B | GO:1902410 | mitotic cytokinetic process |
| 3. B | GO:0045600 | positive regulation of fat cell differentiation |
| 3. B | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 3. B | GO:0003691 | double-stranded telomeric DNA binding |
| 3. B | GO:0045591 | positive regulation of regulatory T cell differentiation |
| 3. B | GO:0009888 | tissue development |
| 3. B | GO:1903688 | positive regulation of border follicle cell migration |
| 3. B | GO:0048060 | negative gravitaxis |
| 3. B | GO:0016198 | axon choice point recognition |
| 3. B | GO:0043372 | positive regulation of CD4-positive, alpha-beta T cell differentiation |
| 3. B | GO:0006338 | chromatin remodeling |
| 3. B | GO:0035167 | larval lymph gland hemopoiesis |
| 3. B | GO:0008327 | methyl-CpG binding |
| 3. B | GO:0090336 | positive regulation of brown fat cell differentiation |
| 3. B | GO:0048086 | negative regulation of developmental pigmentation |
| 3. B | GO:0007300 | ovarian nurse cell to oocyte transport |
| 3. B | GO:0070418 | DNA-dependent protein kinase complex |
| 3. B | GO:0048872 | homeostasis of number of cells |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0019762 | glucosinolate catabolic process |
| 3. B | GO:0048626 | myoblast fate specification |
| 3. B | GO:0032888 | regulation of mitotic spindle elongation |
| 3. B | GO:0046843 | dorsal appendage formation |
| 3. B | GO:0007301 | female germline ring canal formation |
| 3. B | GO:0060446 | branching involved in open tracheal system development |
| 3. B | GO:0051170 | import into nucleus |
| 3. B | GO:0005576 | extracellular region |
| 3. B | GO:0001161 | intronic transcription regulatory region sequence-specific DNA binding |
| 3. B | GO:0008406 | gonad development |
| 3. B | GO:0030234 | enzyme regulator activity |
| 3. B | GO:0007517 | muscle organ development |
| 3. B | GO:0001752 | compound eye photoreceptor fate commitment |
| 3. B | GO:0005700 | polytene chromosome |
| 3. B | GO:0045656 | negative regulation of monocyte differentiation |
| 3. B | GO:0046889 | positive regulation of lipid biosynthetic process |
| 3. B | GO:0042127 | regulation of cell population proliferation |
| 3. B | GO:0032225 | regulation of synaptic transmission, dopaminergic |
| 3. B | GO:0016319 | mushroom body development |
| 3. B | GO:0000117 | regulation of transcription involved in G2/M transition of mitotic cell cycle |
| 3. B | GO:0140297 | DNA-binding transcription factor binding |
| 3. B | GO:0008346 | larval walking behavior |
| 3. B | GO:0007266 | Rho protein signal transduction |
| 3. B | GO:0061040 | female gonad morphogenesis |
| 3. B | GO:0140627 | ubiquitin-dependent protein catabolic process via the C-end degron rule pathway |
| 3. B | GO:0016476 | regulation of embryonic cell shape |
| 3. B | GO:0043565 | sequence-specific DNA binding |
| 3. B | GO:0035070 | salivary gland histolysis |
| 3. B | GO:0000083 | regulation of transcription involved in G1/S transition of mitotic cell cycle |
| 3. B | GO:0048092 | negative regulation of male pigmentation |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0071472 | cellular response to salt stress |
| 3. B | GO:0030162 | regulation of proteolysis |
| 3. B | GO:0061059 | positive regulation of peptidoglycan recognition protein signaling pathway |
| 3. B | GO:0010529 | negative regulation of transposition |
| 3. B | GO:1901409 | positive regulation of phosphorylation of RNA polymerase II C-terminal domain |
| 3. B | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding |
| 3. B | GO:1903464 | negative regulation of mitotic cell cycle DNA replication |
| 3. B | GO:0007455 | eye-antennal disc morphogenesis |
| 3. B | GO:0035035 | histone acetyltransferase binding |
| 3. B | GO:0040034 | regulation of development, heterochronic |
| 3. B | GO:0007283 | spermatogenesis |
| 3. B | GO:0048047 | mating behavior, sex discrimination |
| 3. B | GO:0007464 | R3/R4 cell fate commitment |
| 3. B | GO:0002682 | regulation of immune system process |
| 3. B | GO:0030853 | negative regulation of granulocyte differentiation |
| 3. B | GO:0017053 | transcription repressor complex |
| 3. B | GO:1990511 | piRNA biosynthetic process |
| 3. B | GO:0035183 | female germline ring canal inner rim |
| 3. B | GO:0019985 | translesion synthesis |
| 3. B | GO:0016545 | male courtship behavior, veined wing vibration |
| 3. B | GO:0035214 | eye-antennal disc development |
| 3. B | GO:1901044 | protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process |
| 3. B | GO:0016544 | male courtship behavior, tapping to detect pheromone |
| 3. B | GO:0045433 | male courtship behavior, veined wing generated song production |
| 3. B | GO:0035151 | regulation of tube size, open tracheal system |
| 3. B | GO:0030890 | positive regulation of B cell proliferation |
| 3. B | GO:0080028 | nitrile biosynthetic process |
| 3. B | GO:0048813 | dendrite morphogenesis |
| 3. B | GO:0006970 | response to osmotic stress |
| 3. B | GO:0140014 | mitotic nuclear division |
| 3. B | GO:0035075 | response to ecdysone |
| 3. B | GO:0006355 | regulation of transcription, DNA-templated |
| 3. B | GO:0045629 | negative regulation of T-helper 2 cell differentiation |
| 3. B | GO:0045670 | regulation of osteoclast differentiation |
| 3. B | GO:0001222 | transcription corepressor binding |
| 3. B | GO:0010596 | negative regulation of endothelial cell migration |
| 3. B | GO:0043249 | erythrocyte maturation |
| 3. B | GO:0048477 | oogenesis |
| 3. B | GO:0048821 | erythrocyte development |
| 3. B | GO:0060976 | coronary vasculature development |
| 3. B | GO:0002829 | negative regulation of type 2 immune response |
| 3. B | GO:0048071 | sex-specific pigmentation |
| 3. B | GO:0001046 | core promoter sequence-specific DNA binding |
| 3. B | GO:0045172 | germline ring canal |
| 3. B | GO:0098813 | nuclear chromosome segregation |
| 3. B | GO:0031462 | Cul2-RING ubiquitin ligase complex |
| 3. B | GO:0045595 | regulation of cell differentiation |
| 3. B | GO:0051141 | negative regulation of NK T cell proliferation |
| 3. B | GO:2000677 | regulation of transcription regulatory region DNA binding |
| 3. B | GO:0090721 | primary adaptive immune response involving T cells and B cells |
| 3. B | GO:0006110 | regulation of glycolytic process |
| 3. B | GO:2000640 | positive regulation of SREBP signaling pathway |
| 3. B | GO:0006964 | positive regulation of biosynthetic process of antibacterial peptides active against Gram-negative bacteria |
| 3. B | GO:0007411 | axon guidance |
| 3. B | GO:0055001 | muscle cell development |
| 3. B | GO:1903025 | regulation of RNA polymerase II regulatory region sequence-specific DNA binding |
| 3. B | GO:0061418 | regulation of transcription from RNA polymerase II promoter in response to hypoxia |
| 3. B | GO:0071688 | striated muscle myosin thick filament assembly |
| 3. B | GO:1990845 | adaptive thermogenesis |
| 3. B | GO:0007398 | ectoderm development |
| 3. B | GO:0003680 | minor groove of adenine-thymine-rich DNA binding |
| 3. B | GO:0060766 | negative regulation of androgen receptor signaling pathway |
| 3. B | GO:0016199 | axon midline choice point recognition |
| 3. B | GO:0045892 | negative regulation of transcription, DNA-templated |
| 3. B | GO:0045476 | nurse cell apoptotic process |
| 3. B | GO:0031625 | ubiquitin protein ligase binding |
| 3. B | GO:1990615 | Kelch-containing formin regulatory complex |
| 3. B | GO:0016857 | racemase and epimerase activity, acting on carbohydrates and derivatives |
| 3. B | GO:0048065 | male courtship behavior, veined wing extension |
| 3. B | GO:0035147 | branch fusion, open tracheal system |
| 3. B | GO:0035024 | negative regulation of Rho protein signal transduction |
| 3. B | GO:0007526 | larval somatic muscle development |
| 3. B | GO:0035324 | female germline ring canal |
| 3. B | GO:0016543 | male courtship behavior, orientation prior to leg tapping and wing vibration |
| 3. B | GO:0048053 | R1/R6 development |
| 3. B | GO:0009608 | response to symbiont |
| 3. B | GO:0008285 | negative regulation of cell population proliferation |
| 3. B | GO:0120177 | negative regulation of torso signaling pathway |
| 3. B | GO:0010833 | telomere maintenance via telomere lengthening |
| 3. B | GO:0000209 | protein polyubiquitination |
| 3. B | GO:2000176 | positive regulation of pro-T cell differentiation |
| 3. B | GO:0001228 | DNA-binding transcription activator activity, RNA polymerase II-specific |
| 3. B | GO:0048294 | negative regulation of isotype switching to IgE isotypes |
| 3. B | GO:0007478 | leg disc morphogenesis |
| 3. B | GO:0007141 | male meiosis I |
| 3. B | GO:2001199 | negative regulation of dendritic cell differentiation |
| 3. B | GO:0003700 | DNA-binding transcription factor activity |
| 3. B | GO:0045444 | fat cell differentiation |
| 3. B | GO:0032825 | positive regulation of natural killer cell differentiation |
| 3. B | GO:0051090 | regulation of DNA-binding transcription factor activity |
| 3. B | GO:0045650 | negative regulation of macrophage differentiation |
| 3. B | GO:0005634 | nucleus |
| 3. B | GO:0071390 | cellular response to ecdysone |
| 3. B | GO:0010629 | negative regulation of gene expression |
| 3. B | GO:0022008 | neurogenesis |
| 3. B | GO:0001953 | negative regulation of cell-matrix adhesion |
| 3. B | GO:0042682 | regulation of compound eye cone cell fate specification |
| 3. B | GO:0000977 | RNA polymerase II transcription regulatory region sequence-specific DNA binding |
| 3. B | GO:0045677 | negative regulation of R7 cell differentiation |
| 3. B | GO:0043380 | regulation of memory T cell differentiation |
| 3. B | GO:0048750 | compound eye corneal lens morphogenesis |
| 3. B | GO:0030707 | ovarian follicle cell development |
| 3. B | GO:0090337 | regulation of formin-nucleated actin cable assembly |
| 3. B | GO:0042332 | gravitaxis |
| 3. B | GO:0043376 | regulation of CD8-positive, alpha-beta T cell differentiation |
| 3. B | GO:0001817 | regulation of cytokine production |
| 3. B | GO:1990756 | ubiquitin ligase-substrate adaptor activity |
| 3. B | GO:0000785 | chromatin |
| 3. B | GO:0034504 | protein localization to nucleus |
| 3. B | GO:2001200 | positive regulation of dendritic cell differentiation |
| 3. B | GO:0030183 | B cell differentiation |
| 3. B | GO:2000320 | negative regulation of T-helper 17 cell differentiation |
| 3. B | GO:0001223 | transcription coactivator binding |
| 3. B | GO:0007458 | progression of morphogenetic furrow involved in compound eye morphogenesis |
| 3. B | GO:0045746 | negative regulation of Notch signaling pathway |
| 3. B | GO:0003682 | chromatin binding |
| 3. B | GO:0043377 | negative regulation of CD8-positive, alpha-beta T cell differentiation |
| 3. B | GO:0040003 | chitin-based cuticle development |
| 3. B | GO:0008270 | zinc ion binding |
| 3. B | GO:0007278 | pole cell fate determination |
| 3. B | GO:0006357 | regulation of transcription by RNA polymerase II |
| 3. B | GO:0046628 | positive regulation of insulin receptor signaling pathway |
| 3. B | GO:0003279 | cardiac septum development |
| 3. B | GO:1990837 | sequence-specific double-stranded DNA binding |
| 3. B | GO:0000981 | DNA-binding transcription factor activity, RNA polymerase II-specific |
| 3. B | GO:0097680 | double-strand break repair via classical nonhomologous end joining |
| 3. B | GO:0042631 | cellular response to water deprivation |
| 3. B | GO:0019102 | male somatic sex determination |
| 3. B | GO:0051138 | positive regulation of NK T cell differentiation |
| 3. B | GO:0001702 | gastrulation with mouth forming second |
| 3. B | GO:0050681 | androgen receptor binding |
| 3. B | GO:0042789 | mRNA transcription by RNA polymerase II |
| 3. B | GO:0035001 | dorsal trunk growth, open tracheal system |
| 3. B | GO:0046332 | SMAD binding |
| 3. B | GO:0007426 | tracheal outgrowth, open tracheal system |
| 3. B | GO:2000104 | negative regulation of DNA-dependent DNA replication |
| 3. B | GO:0051272 | positive regulation of cellular component movement |
| 3. B | GO:0031065 | positive regulation of histone deacetylation |
| 3. B | GO:0000792 | heterochromatin |
| 3. B | GO:0032740 | positive regulation of interleukin-17 production |
| 3. B | GO:0045582 | positive regulation of T cell differentiation |
| 3. B | GO:0001865 | NK T cell differentiation |
| 3. B | GO:0042675 | compound eye cone cell differentiation |
| 3. B | GO:0008049 | male courtship behavior |
| 3. B | GO:0007519 | skeletal muscle tissue development |
| 3. B | GO:0016607 | nuclear speck |
| 3. B | GO:0045467 | R7 cell development |
| 3. B | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway |
| 3. B | GO:0002711 | positive regulation of T cell mediated immunity |
| 3. B | GO:0050727 | regulation of inflammatory response |
| 3. B | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 3. B | GO:0032874 | positive regulation of stress-activated MAPK cascade |
| 3. B | GO:0010114 | response to red light |
| 3. B | GO:0045821 | positive regulation of glycolytic process |
| 3. B | GO:2000773 | negative regulation of cellular senescence |
| 3. B | GO:0007562 | eclosion |
| 3. B | GO:0045893 | positive regulation of transcription, DNA-templated |
| 3. B | GO:0030292 | protein tyrosine kinase inhibitor activity |
| 3. B | GO:0046580 | negative regulation of Ras protein signal transduction |
| 3. B | GO:0003170 | heart valve development |
| 3. B | GO:0110070 | cellularization cleavage furrow |
| 3. B | GO:0042092 | type 2 immune response |
| 3. B | GO:0032764 | negative regulation of mast cell cytokine production |
| 3. B | GO:0046982 | protein heterodimerization activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | E9QIN8 | Kelch-like protein 41a | 0.00e+00 | 1.19e-63 | 7.46e-53 |
| 1. PB | Q9Y2M5 | Kelch-like protein 20 | 0.00e+00 | 5.29e-25 | 1.10e-65 |
| 1. PB | Q5PQR3 | BTB/POZ domain-containing protein 9 | 1.39e-05 | 1.36e-03 | 9.05e-11 |
| 1. PB | Q5REP9 | Kelch-like protein 3 | 0.00e+00 | 1.72e-38 | 1.19e-59 |
| 1. PB | A0A1B8YAB1 | Kelch repeat and BTB domain-containing protein 8 | 0.00e+00 | 2.11e-47 | 9.53e-59 |
| 1. PB | Q9JFG1 | Kelch repeat protein C2 | NA | 1.94e-38 | 3.81e-11 |
| 1. PB | Q8JZP3 | Kelch-like protein 2 | 0.00e+00 | 7.42e-37 | 1.80e-55 |
| 1. PB | Q1LYM6 | Kelch-like protein 38 | 0.00e+00 | 1.64e-66 | 6.50e-42 |
| 1. PB | A6NCF5 | Kelch-like protein 33 | 4.77e-15 | 7.46e-35 | 1.34e-20 |
| 1. PB | Q16RL8 | Kelch-like protein diablo | 0.00e+00 | 6.12e-39 | 1.34e-67 |
| 1. PB | Q9CZ49 | Kelch-like protein 35 | 0.00e+00 | 1.15e-47 | 2.95e-50 |
| 1. PB | B3DIV9 | Kelch-like protein 40a | 0.00e+00 | 6.38e-60 | 3.75e-57 |
| 1. PB | P21037 | Kelch repeat protein C2 | NA | 2.36e-38 | 4.90e-14 |
| 1. PB | A2AUC9 | Kelch-like protein 41 | 0.00e+00 | 2.95e-64 | 4.99e-47 |
| 1. PB | Q8BNW9 | Kelch repeat and BTB domain-containing protein 11 | 2.80e-07 | 5.29e-13 | 7.24e-08 |
| 1. PB | Q9C0H6 | Kelch-like protein 4 | 0.00e+00 | 1.55e-05 | 8.41e-50 |
| 1. PB | Q8BFQ9 | Kelch-like protein 42 | 6.21e-10 | 1.01e-33 | 7.78e-09 |
| 1. PB | Q6TFL4 | Kelch-like protein 24 | 0.00e+00 | 1.74e-42 | 2.81e-56 |
| 1. PB | A2AAX3 | Kelch-like protein 15 | 0.00e+00 | 9.54e-69 | 5.36e-37 |
| 1. PB | Q9NVX7 | Kelch repeat and BTB domain-containing protein 4 | 7.44e-15 | 6.11e-42 | 1.38e-19 |
| 1. PB | P32228 | Protein C4 | NA | 1.32e-55 | 2.57e-17 |
| 1. PB | Q14145 | Kelch-like ECH-associated protein 1 | 0.00e+00 | 5.07e-26 | 2.08e-49 |
| 1. PB | Q5ZLD3 | Kelch-like protein 13 | 0.00e+00 | 2.19e-42 | 2.56e-36 |
| 1. PB | P32206 | Protein C13 | NA | 7.60e-43 | 3.72e-10 |
| 1. PB | Q5RGB8 | Kelch-like protein 26 | 0.00e+00 | 2.43e-53 | 8.31e-53 |
| 1. PB | Q8BWA5 | Kelch-like protein 31 | 1.11e-16 | 2.93e-41 | 7.41e-32 |
| 1. PB | F1MBP6 | Kelch-like protein 3 | 0.00e+00 | 6.76e-38 | 5.23e-61 |
| 1. PB | Q684M4 | Kelch-like ECH-associated protein 1 | 0.00e+00 | 1.57e-25 | 1.60e-50 |
| 1. PB | Q5ZKD9 | Kelch-like protein 20 | 0.00e+00 | 9.86e-26 | 1.15e-62 |
| 1. PB | Q7QGL0 | Kelch-like protein diablo | 0.00e+00 | 4.11e-37 | 2.43e-66 |
| 1. PB | B3NDN0 | Kelch-like protein diablo | 0.00e+00 | 2.10e-22 | 6.12e-65 |
| 1. PB | O94819 | Kelch repeat and BTB domain-containing protein 11 | 1.28e-07 | 1.91e-10 | 1.31e-07 |
| 1. PB | Q8IY47 | Kelch repeat and BTB domain-containing protein 2 | 0.00e+00 | 7.33e-63 | 1.34e-52 |
| 1. PB | Q3ZB90 | Kelch repeat and BTB domain-containing protein 12 | 0.00e+00 | 8.93e-80 | 0.0 |
| 1. PB | D3ZZC3 | Kelch-like protein 22 | 0.00e+00 | 5.77e-58 | 3.39e-32 |
| 1. PB | Q3UQV5 | Kelch repeat and BTB domain-containing protein 8 | 0.00e+00 | 1.00e-47 | 9.61e-60 |
| 1. PB | Q8IXQ5 | Kelch-like protein 7 | 0.00e+00 | 7.84e-53 | 5.34e-52 |
| 1. PB | Q9UH77 | Kelch-like protein 3 | 0.00e+00 | 4.47e-39 | 1.05e-60 |
| 1. PB | E9Q4F2 | Kelch-like protein 18 | 0.00e+00 | 7.51e-45 | 7.68e-58 |
| 1. PB | Q3U410 | Kelch-like protein 21 | 0.00e+00 | 3.76e-41 | 4.53e-44 |
| 1. PB | O35709 | Ectoderm-neural cortex protein 1 | 0.00e+00 | 1.60e-58 | 7.51e-33 |
| 1. PB | Q6JEL2 | Kelch-like protein 10 | 0.00e+00 | 3.00e-46 | 1.93e-40 |
| 1. PB | Q8BUL5 | Kelch-like protein 7 | 0.00e+00 | 3.91e-53 | 2.17e-51 |
| 1. PB | Q6Q7X9 | Kelch-like protein 31 | 0.00e+00 | 3.12e-45 | 1.31e-33 |
| 1. PB | Q2M0J9 | Kelch-like protein diablo | 0.00e+00 | 3.51e-21 | 1.72e-65 |
| 1. PB | Q8QQ16 | Kelch repeat and BTB domain-containing protein 1 | NA | 1.84e-56 | 5.54e-26 |
| 1. PB | Q8N4N3 | Kelch-like protein 36 | 0.00e+00 | 8.30e-64 | 2.08e-36 |
| 1. PB | Q5U374 | Kelch-like protein 12 | 0.00e+00 | 7.31e-48 | 1.41e-61 |
| 1. PB | Q8C726 | BTB/POZ domain-containing protein 9 | 4.63e-05 | 2.17e-04 | 1.98e-10 |
| 1. PB | Q9H2C0 | Gigaxonin | 0.00e+00 | 1.98e-62 | 5.32e-33 |
| 1. PB | Q10579 | Spermatocyte protein spe-26 | 2.29e-10 | 1.45e-34 | 1.89e-04 |
| 1. PB | Q3B7M1 | Kelch-like protein 36 | 0.00e+00 | 9.85e-66 | 2.14e-35 |
| 1. PB | Q28068 | Calicin | 0.00e+00 | 2.07e-52 | 1.22e-15 |
| 1. PB | Q5U575 | Kelch-like protein 21 | 1.02e-14 | 1.29e-45 | 6.23e-48 |
| 1. PB | O72756 | Kelch repeat and BTB domain-containing protein 2 | NA | 1.26e-46 | 2.84e-18 |
| 1. PB | Q5RG82 | Influenza virus NS1A-binding protein homolog A | 3.67e-11 | 1.63e-37 | 3.58e-16 |
| 1. PB | Q8WVZ9 | Kelch repeat and BTB domain-containing protein 7 | 0.00e+00 | 3.97e-34 | 1.32e-47 |
| 1. PB | Q8BHI4 | Kelch repeat and BTB domain-containing protein 3 | 9.99e-16 | 6.82e-53 | 7.31e-39 |
| 1. PB | D2HEW7 | Kelch-like protein 22 | 0.00e+00 | 2.18e-53 | 8.52e-33 |
| 1. PB | F1LZ52 | Kelch-like protein 3 | 0.00e+00 | 1.46e-40 | 3.28e-60 |
| 1. PB | Q6NYM1 | Kelch-like protein 21 | 0.00e+00 | 9.73e-47 | 1.69e-44 |
| 1. PB | Q6DFF6 | Kelch-like protein 20 | 0.00e+00 | 2.90e-27 | 1.37e-65 |
| 1. PB | P28575 | Actin-binding protein IPP | 0.00e+00 | 2.31e-56 | 4.05e-47 |
| 1. PB | P08073 | Kelch repeat protein M-T9 | NA | 1.09e-49 | 5.24e-10 |
| 1. PB | Q5R774 | Kelch-like ECH-associated protein 1 | 0.00e+00 | 7.28e-25 | 2.12e-49 |
| 1. PB | Q8WZ60 | Kelch-like protein 6 | 0.00e+00 | 1.50e-44 | 5.53e-45 |
| 1. PB | Q9P2N7 | Kelch-like protein 13 | 0.00e+00 | 1.30e-30 | 2.25e-37 |
| 1. PB | Q0GNN1 | Kelch repeat and BTB domain-containing protein 2 | NA | 3.70e-46 | 2.97e-14 |
| 1. PB | Q0D2A9 | Kelch-like protein 25 | 0.00e+00 | 2.93e-55 | 1.94e-41 |
| 1. PB | Q6RZS3 | Kelch repeat protein C2 | NA | 5.16e-39 | 4.30e-11 |
| 1. PB | D3Z8N4 | Kelch-like protein 20 | 0.00e+00 | 5.29e-25 | 1.10e-65 |
| 1. PB | Q6V595 | Kelch-like protein 6 | 0.00e+00 | 4.08e-47 | 1.62e-44 |
| 1. PB | Q6DEL7 | Kelch-like protein 15 | 0.00e+00 | 6.17e-72 | 2.24e-34 |
| 1. PB | Q6PF15 | Kelch-like protein 35 | 0.00e+00 | 6.27e-42 | 3.61e-47 |
| 1. PB | D3ZA50 | Kelch-like protein 15 | 0.00e+00 | 9.54e-69 | 5.36e-37 |
| 1. PB | Q8NAB2 | Kelch repeat and BTB domain-containing protein 3 | 1.11e-15 | 2.34e-51 | 4.68e-40 |
| 1. PB | B4L0G9 | Kelch-like protein diablo | 0.00e+00 | 1.80e-21 | 1.93e-65 |
| 1. PB | P59280 | Kelch-like protein 8 | 0.00e+00 | 1.88e-27 | 7.81e-43 |
| 1. PB | Q8R2H4 | Kelch-like protein 12 | 0.00e+00 | 2.08e-49 | 9.38e-58 |
| 1. PB | B4HIK1 | Kelch-like protein diablo | 0.00e+00 | 2.31e-22 | 8.41e-65 |
| 1. PB | Q9NR64 | Kelch-like protein 1 | 0.00e+00 | 3.28e-03 | 5.91e-44 |
| 1. PB | Q6DFU2 | Influenza virus NS1A-binding protein homolog | 1.82e-11 | 3.03e-39 | 3.90e-25 |
| 1. PB | O14682 | Ectoderm-neural cortex protein 1 | 0.00e+00 | 2.62e-59 | 3.82e-32 |
| 1. PB | Q5U504 | Kelch-like protein 40 | 0.00e+00 | 8.95e-59 | 6.36e-56 |
| 1. PB | Q8CDE2 | Calicin | 0.00e+00 | 5.19e-51 | 1.24e-14 |
| 1. PB | Q6JEL3 | Kelch-like protein 10 | 0.00e+00 | 8.09e-47 | 1.70e-40 |
| 1. PB | Q08CY1 | Kelch-like protein 22 | 0.00e+00 | 5.34e-49 | 2.03e-35 |
| 1. PB | Q9Z2X8 | Kelch-like ECH-associated protein 1 | 0.00e+00 | 2.69e-25 | 4.04e-49 |
| 1. PB | Q9Y573 | Actin-binding protein IPP | 0.00e+00 | 7.77e-57 | 1.68e-50 |
| 1. PB | Q8BRG6 | Kelch-like protein 24 | 0.00e+00 | 2.42e-42 | 2.16e-56 |
| 1. PB | Q9NVR0 | Kelch-like protein 11 | 3.55e-11 | 1.88e-22 | 3.96e-24 |
| 1. PB | Q9CR40 | Kelch-like protein 28 | 0.00e+00 | 1.29e-43 | 2.86e-55 |
| 1. PB | Q2T9Z7 | Kelch-like protein 9 | 0.00e+00 | 2.18e-53 | 1.83e-36 |
| 1. PB | E1B932 | Kelch-like protein 12 | 0.00e+00 | 1.93e-48 | 5.13e-57 |
| 1. PB | Q5ZI33 | Kelch-like protein 7 | 0.00e+00 | 1.13e-52 | 1.22e-50 |
| 1. PB | Q5XI58 | Calicin | 0.00e+00 | 4.58e-50 | 1.38e-11 |
| 1. PB | Q08DS0 | Kelch-like protein 21 | 0.00e+00 | 1.12e-39 | 1.77e-42 |
| 1. PB | B4GRJ2 | Kelch-like protein diablo | 0.00e+00 | 1.26e-21 | 1.57e-65 |
| 1. PB | Q8JLI4 | Kelch repeat protein C2 | NA | 1.32e-38 | 3.64e-11 |
| 1. PB | Q8BGY4 | Kelch-like protein 26 | 0.00e+00 | 1.06e-52 | 2.76e-55 |
| 1. PB | Q776A6 | Kelch repeat protein C2 | NA | 1.49e-38 | 5.03e-13 |
| 1. PB | Q9Y6Y0 | Influenza virus NS1A-binding protein | 1.11e-11 | 1.20e-37 | 3.46e-17 |
| 1. PB | Q8R179 | Kelch repeat and BTB domain-containing protein 4 | 2.98e-11 | 4.02e-36 | 1.38e-19 |
| 1. PB | Q08DK3 | Kelch-like protein 20 | 0.00e+00 | 5.29e-25 | 1.10e-65 |
| 1. PB | C9JR72 | Kelch repeat and BTB domain-containing protein 13 | 3.26e-10 | 1.74e-24 | 5.91e-05 |
| 1. PB | Q9P2G3 | Kelch-like protein 14 | 1.11e-16 | 3.03e-39 | 4.48e-27 |
| 1. PB | Q9NXS3 | Kelch-like protein 28 | 0.00e+00 | 4.89e-44 | 1.68e-54 |
| 1. PB | Q9UJP4 | Kelch-like protein 21 | 0.00e+00 | 1.14e-42 | 6.88e-44 |
| 1. PB | B4LIG6 | Kelch-like protein diablo | 0.00e+00 | 3.07e-24 | 1.60e-65 |
| 1. PB | Q8R124 | Kelch-like protein 36 | 0.00e+00 | 1.77e-65 | 1.61e-33 |
| 1. PB | Q5R7B8 | Kelch-like protein 20 | 0.00e+00 | 4.37e-24 | 8.09e-65 |
| 1. PB | Q96M94 | Kelch-like protein 15 | 0.00e+00 | 3.05e-68 | 2.26e-36 |
| 1. PB | Q53G59 | Kelch-like protein 12 | 0.00e+00 | 1.42e-50 | 5.02e-57 |
| 1. PB | Q0GNQ5 | Kelch repeat and BTB domain-containing protein 1 | NA | 1.34e-56 | 1.77e-27 |
| 1. PB | Q53HC5 | Kelch-like protein 26 | 0.00e+00 | 1.70e-42 | 9.81e-48 |
| 1. PB | Q9P2J3 | Kelch-like protein 9 | 0.00e+00 | 1.19e-52 | 2.98e-37 |
| 1. PB | P17371 | Kelch repeat protein C2 | NA | 3.30e-38 | 6.05e-13 |
| 1. PB | B1H285 | Kelch repeat and BTB domain-containing protein 8 | 0.00e+00 | 2.06e-57 | 2.72e-59 |
| 1. PB | Q8BZM0 | Kelch-like protein 12 | 0.00e+00 | 5.20e-49 | 9.10e-58 |
| 1. PB | Q9VUU5 | Kelch-like protein diablo | 0.00e+00 | 2.31e-22 | 8.41e-65 |
| 1. PB | P24768 | Kelch repeat and BTB domain-containing protein A55 | NA | 1.09e-57 | 4.38e-28 |
| 1. PB | Q8NBE8 | Kelch-like protein 23 | 1.67e-15 | 2.41e-58 | 1.00e-41 |
| 1. PB | O60662 | Kelch-like protein 41 | 0.00e+00 | 7.70e-66 | 8.48e-50 |
| 1. PB | Q69ZK5 | Kelch-like protein 14 | 1.11e-16 | 2.77e-36 | 1.53e-26 |
| 1. PB | Q8CA72 | Gigaxonin | 0.00e+00 | 4.52e-63 | 4.72e-33 |
| 1. PB | Q9D783 | Kelch-like protein 40 | 0.00e+00 | 3.00e-57 | 6.72e-43 |
| 1. PB | E9QJ30 | Kelch-like protein 40b | 1.67e-15 | 2.56e-58 | 6.72e-54 |
| 1. PB | P21073 | Kelch repeat and BTB domain-containing protein 1 | NA | 6.48e-58 | 2.51e-28 |
| 1. PB | B4PD06 | Kelch-like protein diablo | 0.00e+00 | 2.31e-22 | 8.41e-65 |
| 1. PB | D4A2K4 | Kelch-like protein 21 | 0.00e+00 | 3.08e-41 | 5.98e-45 |
| 1. PB | Q5RCQ9 | Kelch-like protein 23 | 0.00e+00 | 3.23e-58 | 2.54e-42 |
| 1. PB | P57790 | Kelch-like ECH-associated protein 1 | 0.00e+00 | 5.57e-29 | 1.43e-47 |
| 1. PB | A4IFG2 | BTB/POZ domain-containing protein 9 | 4.79e-05 | 1.17e-05 | 9.12e-11 |
| 1. PB | Q9JFS4 | Kelch repeat and BTB domain-containing protein 2 | NA | 4.41e-42 | 2.65e-16 |
| 1. PB | Q4KLM4 | Kelch-like protein 25 | 0.00e+00 | 4.66e-54 | 3.10e-43 |
| 1. PB | O72736 | Kelch repeat and BTB domain-containing protein 1 | NA | 2.19e-59 | 2.75e-28 |
| 1. PB | Q8N239 | Kelch-like protein 34 | 3.33e-16 | 2.89e-54 | 6.15e-27 |
| 1. PB | Q5F3N5 | Kelch-like protein 14 | 0.00e+00 | 2.13e-42 | 9.06e-34 |
| 1. PB | E7F6F9 | Kelch-like protein 3 | 0.00e+00 | 2.77e-35 | 4.55e-54 |
| 1. PB | Q9D618 | Kelch repeat and BTB domain-containing protein 12 | 0.00e+00 | 1.58e-116 | 0.0 |
| 1. PB | Q5R663 | Kelch repeat and BTB domain-containing protein 3 | 1.22e-15 | 1.50e-50 | 2.35e-40 |
| 1. PB | Q8R2P1 | Kelch-like protein 25 | 0.00e+00 | 2.40e-55 | 1.87e-42 |
| 1. PB | Q6DFF7 | Kelch-like protein 25 | 1.11e-16 | 4.63e-57 | 8.04e-43 |
| 1. PB | Q99JN2 | Kelch-like protein 22 | 0.00e+00 | 4.76e-57 | 1.45e-31 |
| 1. PB | E0CZ16 | Kelch-like protein 3 | 0.00e+00 | 4.05e-39 | 3.32e-60 |
| 1. PB | Q8C828 | Kelch repeat and BTB domain-containing protein 13 | 3.38e-10 | 1.12e-24 | 6.83e-04 |
| 1. PB | Q9D5V2 | Kelch-like protein 10 | 0.00e+00 | 1.11e-46 | 1.56e-40 |
| 1. PB | Q9JI74 | Kelch-like protein 1 | 0.00e+00 | 1.67e-03 | 2.39e-45 |
| 1. PB | O95198 | Kelch-like protein 2 | 0.00e+00 | 1.22e-36 | 2.63e-54 |
| 1. PB | A0A2R8Q1W5 | Kelch-like ECH-associated protein 1B | 0.00e+00 | 3.18e-39 | 1.45e-46 |
| 1. PB | Q6GQU2 | Kelch-like protein 23 | 3.00e-15 | 4.37e-57 | 5.18e-42 |
| 1. PB | Q8QMQ2 | Kelch repeat and BTB domain-containing protein 1 | NA | 3.31e-59 | 4.10e-27 |
| 1. PB | Q8V2Z3 | Kelch repeat protein C2 | NA | 1.49e-38 | 5.03e-13 |
| 1. PB | Q6INL2 | Kelch-like protein 30 | 0.00e+00 | 2.92e-51 | 7.95e-38 |
| 1. PB | Q08CL3 | Kelch repeat and BTB domain-containing protein 8 | 0.00e+00 | 6.17e-50 | 4.69e-54 |
| 1. PB | Q920Q8 | Influenza virus NS1A-binding protein homolog | 2.41e-10 | 6.60e-38 | 1.46e-35 |
| 1. PB | Q8C3F7 | Kelch-like protein 30 | 0.00e+00 | 2.06e-54 | 1.06e-42 |
| 1. PB | Q5XHZ6 | Kelch-like protein 7 | 0.00e+00 | 1.11e-54 | 7.64e-51 |
| 1. PB | Q9ER30 | Kelch-like protein 41 | 0.00e+00 | 1.05e-64 | 5.73e-47 |
| 1. PB | B3M9V8 | Kelch-like protein diablo | 0.00e+00 | 3.73e-19 | 1.90e-64 |
| 1. PB | Q5BK60 | Kelch-like protein 38 | 0.00e+00 | 5.76e-63 | 1.46e-40 |
| 1. PB | O94889 | Kelch-like protein 18 | 0.00e+00 | 5.95e-45 | 9.75e-55 |
| 1. PB | Q5ZJU2 | Kelch-like protein 15 | 0.00e+00 | 3.04e-36 | 2.60e-25 |
| 1. PB | P24357 | Kelch repeat protein F3 | NA | 4.17e-33 | 5.08e-11 |
| 1. PB | Q56A24 | Kelch-like protein 24 | 0.00e+00 | 2.42e-42 | 2.16e-56 |
| 1. PB | Q8JL69 | Kelch repeat and BTB domain-containing protein 1 | NA | 8.97e-57 | 4.53e-25 |
| 1. PB | Q96G42 | Kelch domain-containing protein 7B | 5.98e-06 | 2.12e-06 | 0.003 |
| 1. PB | Q802Y8 | Zinc finger and BTB domain-containing protein 16-A | 8.57e-01 | 1.64e-02 | 0.042 |
| 1. PB | Q6TDP3 | Kelch-like protein 17 | 0.00e+00 | 1.48e-24 | 2.34e-61 |
| 1. PB | Q6NRH0 | Kelch-like protein 12 | 0.00e+00 | 3.39e-47 | 1.57e-52 |
| 1. PB | Q503R4 | Kelch-like protein 36 | 0.00e+00 | 6.50e-63 | 4.38e-38 |
| 1. PB | Q9H511 | Kelch-like protein 31 | 1.11e-16 | 1.71e-44 | 1.22e-29 |
| 1. PB | Q5EB39 | Kelch-like protein 40 | 0.00e+00 | 3.26e-56 | 2.62e-53 |
| 1. PB | Q8QMN3 | Kelch repeat and BTB domain-containing protein 2 | NA | 5.92e-46 | 2.04e-16 |
| 1. PB | A6QQY2 | Kelch-like protein 13 | 0.00e+00 | 1.62e-29 | 2.61e-37 |
| 1. PB | Q86V97 | Kelch repeat and BTB domain-containing protein 6 | 0.00e+00 | 2.28e-32 | 1.79e-41 |
| 1. PB | Q1ECZ2 | Kelch-like ECH-associated protein 1A | 0.00e+00 | 1.98e-42 | 2.93e-50 |
| 1. PB | B4MXW3 | Kelch-like protein diablo | 2.22e-16 | 4.29e-14 | 1.41e-64 |
| 1. PB | P87617 | Kelch repeat protein C2 | NA | 7.24e-39 | 1.41e-13 |
| 1. PB | P34569 | Kelch repeat-containing protein kel-10 | 1.65e-12 | 1.87e-34 | 1.95e-08 |
| 1. PB | Q6ZPT1 | Kelch-like protein 9 | 0.00e+00 | 1.33e-52 | 9.30e-38 |
| 1. PB | Q6TDP4 | Kelch-like protein 17 | 0.00e+00 | 1.92e-24 | 9.92e-63 |
| 1. PB | Q7ZVQ8 | Influenza virus NS1A-binding protein homolog B | 2.80e-11 | 2.72e-41 | 1.47e-13 |
| 1. PB | Q96Q07 | BTB/POZ domain-containing protein 9 | 5.20e-05 | 3.95e-05 | 7.22e-11 |
| 1. PB | F1QEG2 | Kelch-like protein 41b | 0.00e+00 | 1.73e-59 | 3.43e-48 |
| 1. PB | Q2TBA0 | Kelch-like protein 40 | 0.00e+00 | 7.69e-56 | 1.50e-43 |
| 1. PB | Q8K430 | Kelch-like protein 17 | 0.00e+00 | 1.48e-24 | 2.34e-61 |
| 1. PB | Q5RDY3 | Kelch repeat and BTB domain-containing protein 2 | 0.00e+00 | 1.31e-63 | 9.06e-53 |
| 1. PB | Q5R4S6 | Kelch repeat and BTB domain-containing protein 4 | 3.40e-13 | 6.11e-42 | 1.66e-19 |
| 1. PB | Q53GT1 | Kelch-like protein 22 | 0.00e+00 | 6.86e-56 | 2.29e-33 |
| 1. PB | Q8NFY9 | Kelch repeat and BTB domain-containing protein 8 | 0.00e+00 | 3.30e-47 | 1.08e-60 |
| 1. PB | Q13939 | Calicin | 0.00e+00 | 2.16e-51 | 1.27e-13 |
| 1. PB | B0WWP2 | Kelch-like protein diablo | 0.00e+00 | 2.17e-37 | 1.32e-67 |
| 1. PB | Q0D2K2 | Kelch-like protein 30 | 0.00e+00 | 1.28e-50 | 1.56e-43 |
| 1. PB | Q3ZCT8 | Kelch repeat and BTB domain-containing protein 12 | 0 | 3.77e-142 | 0.0 |
| 1. PB | Q80TF4 | Kelch-like protein 13 | 2.22e-16 | 3.19e-32 | 2.48e-37 |
| 1. PB | B4QLQ2 | Kelch-like protein diablo | 0.00e+00 | 3.64e-22 | 1.04e-64 |
| 1. PB | Q8BSF5 | Kelch-like protein 38 | 0.00e+00 | 4.06e-61 | 2.16e-43 |
| 1. PB | Q9P2G9 | Kelch-like protein 8 | 0.00e+00 | 1.78e-34 | 6.97e-45 |
| 1. PB | B4J045 | Kelch-like protein diablo | 0.00e+00 | 5.31e-22 | 2.17e-65 |
| 1. PB | Q9H0H3 | Kelch-like protein 25 | 0.00e+00 | 7.51e-54 | 1.12e-44 |
| 1. PB | Q9P2K6 | Kelch-like protein 42 | 2.26e-10 | 1.66e-33 | 2.59e-09 |
| 1. PB | Q96NJ5 | Kelch-like protein 32 | 0.00e+00 | 5.29e-58 | 5.00e-41 |
| 1. PB | F1LZF0 | Kelch-like protein 2 | 0.00e+00 | 4.11e-37 | 1.29e-55 |
| 1. PB | Q8CE33 | Kelch-like protein 11 | 7.08e-11 | 1.09e-25 | 1.07e-23 |
| 1. PB | Q2WGJ6 | Kelch-like protein 38 | 0.00e+00 | 4.44e-65 | 1.43e-32 |
| 1. PB | Q09563 | Kelch repeat and BTB domain-containing protein F47D12.7 | 4.88e-10 | 2.02e-37 | 3.90e-07 |
| 1. PB | P22611 | Kelch repeat protein M-T8 | NA | 3.73e-51 | 6.48e-10 |
| 1. PB | Q66HD2 | Kelch-like protein 36 | 0.00e+00 | 1.03e-66 | 1.14e-33 |
| 1. PB | P21013 | Kelch repeat protein F3 | NA | 9.63e-34 | 1.84e-11 |
| 1. PB | G5ED84 | Kelch-like protein 8 | 0.00e+00 | 7.35e-18 | 1.71e-52 |
| 1. PB | Q9N010 | Kelch repeat and BTB domain-containing protein 4 | 6.66e-14 | 9.02e-32 | 2.14e-19 |
| 1. PB | Q8VCK5 | Kelch-like protein 20 | 0.00e+00 | 1.02e-26 | 1.33e-65 |
| 2. P | Q5UQB7 | Putative BTB/POZ domain-containing protein R224 | NA | 1.09e-05 | NA |
| 2. P | Q5UPB5 | Putative BTB/POZ domain-containing protein L35 | NA | 8.45e-03 | NA |
| 2. P | O75529 | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L | 1.25e-03 | 7.05e-04 | NA |
| 2. P | Q5UPG1 | Putative BTB/POZ domain-containing protein L85 | NA | 3.97e-03 | NA |
| 2. P | Q8SQS4 | Transcription initiation factor TFIID subunit 5 | 4.47e-04 | 1.87e-02 | NA |
| 2. P | Q5UPH2 | Putative BTB/POZ domain-containing protein L98 | NA | 1.95e-03 | NA |
| 2. P | Q5UPF2 | Putative BTB/POZ domain-containing protein L76 | NA | 8.43e-04 | NA |
| 2. P | Q8K450 | Sperm-associated antigen 16 protein | 1.88e-03 | 1.35e-03 | NA |
| 2. P | O57174 | Kelch repeat protein F3 | NA | 1.90e-36 | NA |
| 2. P | Q5UNY6 | Putative BTB/POZ domain-containing protein R738 | NA | 4.35e-02 | NA |
| 2. P | Q5UPH7 | Putative BTB/POZ domain-containing protein L107 | NA | 9.99e-05 | NA |
| 2. P | Q5UPR9 | Putative BTB/POZ domain and WD-repeat protein R786 | NA | 1.91e-02 | NA |
| 2. P | Q5UQ07 | Putative BTB/POZ domain-containing protein L788 | NA | 1.05e-13 | NA |
| 2. P | Q5UPD8 | Putative BTB/POZ domain-containing protein L67 | NA | 6.58e-07 | NA |
| 2. P | Q5UPC7 | Putative BTB/POZ domain-containing protein L55 | NA | 2.37e-04 | NA |
| 2. P | Q5URB7 | Putative BTB/POZ domain-containing protein R842 | NA | 2.40e-04 | NA |
| 2. P | Q5UQT6 | Uncharacterized WD repeat-containing protein L344 | NA | 6.35e-07 | NA |
| 2. P | Q91WQ5 | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L | 9.53e-04 | 7.12e-04 | NA |
| 2. P | Q5UQB6 | Putative BTB/POZ domain-containing protein R225 | NA | 2.71e-03 | NA |
| 2. P | Q5UPL6 | Putative BTB/POZ domain and WD-repeat protein R154 | NA | 1.21e-04 | NA |
| 2. P | Q5UPQ3 | Putative BTB/POZ domain-containing protein R765 | NA | 2.98e-04 | NA |
| 2. P | Q5UNY1 | Putative BTB/POZ domain and WD-repeat protein R731 | NA | 1.84e-05 | NA |
| 2. P | Q5UPD3 | Putative BTB/POZ domain and WD-repeat protein R61 | NA | 1.58e-06 | NA |
| 2. P | Q5UNZ2 | Putative BTB/POZ domain and WD-repeat protein R739 | NA | 7.33e-09 | NA |
| 2. P | Q5UQI0 | Putative BTB/POZ domain-containing protein R830 | NA | 4.49e-07 | NA |
| 3. B | Q7TQI7 | Ankyrin repeat and BTB/POZ domain-containing protein 2 | 4.56e-02 | NA | 0.010 |
| 3. B | A0A0A6YY25 | BTB/POZ domain-containing protein 18 | 7.75e-03 | NA | 0.007 |
| 3. B | Q08376 | Zinc finger and BTB domain-containing protein 14 | 8.40e-01 | NA | 1.27e-05 |
| 3. B | Q6P8B3 | Speckle-type POZ protein | 3.84e-07 | NA | 5.71e-05 |
| 3. B | Q0IJ29 | Zinc finger and BTB domain-containing protein 18 | 7.02e-01 | NA | 7.38e-04 |
| 3. B | O80582 | F-box/kelch-repeat protein At2g44130 | 1.37e-04 | NA | 0.007 |
| 3. B | Q24174 | Protein abrupt | 1.42e-02 | NA | 1.27e-07 |
| 3. B | Q4VBD9 | GDNF-inducible zinc finger protein 1 | 6.53e-01 | NA | 0.008 |
| 3. B | Q7TSZ8 | Nucleus accumbens-associated protein 1 | 8.19e-04 | NA | 0.037 |
| 3. B | Q1LVW0 | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-A | 2.48e-02 | NA | 3.02e-05 |
| 3. B | Q5VTJ3 | Kelch domain-containing protein 7A | 1.90e-04 | NA | 2.48e-05 |
| 3. B | Q6ZSB9 | Zinc finger and BTB domain-containing protein 49 | 6.35e-01 | NA | 1.18e-08 |
| 3. B | O43791 | Speckle-type POZ protein | 4.50e-07 | NA | 4.20e-05 |
| 3. B | Q92010 | Zinc finger and BTB domain-containing protein 14 | 7.19e-01 | NA | 5.25e-05 |
| 3. B | O35260 | Nucleus accumbens-associated protein 1 | 6.09e-04 | NA | 0.036 |
| 3. B | P21039 | Protein C5 | NA | NA | 1.02e-04 |
| 3. B | Q0V9W6 | BTB/POZ domain-containing protein 6 | 7.53e-05 | NA | 2.63e-05 |
| 3. B | O88282 | B-cell CLL/lymphoma 6 member B protein | 6.36e-01 | NA | 2.32e-04 |
| 3. B | Q60821 | Zinc finger and BTB domain-containing protein 17 | 9.13e-02 | NA | 1.31e-11 |
| 3. B | Q9WTY8 | Zinc finger and BTB domain-containing protein 10 | 3.81e-02 | NA | 6.42e-08 |
| 3. B | Q9CWH1 | Zinc finger and BTB domain-containing protein 8A | 2.54e-03 | NA | 7.72e-11 |
| 3. B | B1WAZ8 | Zinc finger and BTB domain-containing protein 8A | 4.69e-03 | NA | 7.90e-10 |
| 3. B | A6QL63 | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11 | 5.32e-02 | NA | 1.04e-06 |
| 3. B | Q8NCN2 | Zinc finger and BTB domain-containing protein 34 | 6.80e-04 | NA | 1.39e-04 |
| 3. B | Q86T24 | Transcriptional regulator Kaiso | 8.44e-03 | NA | 0.016 |
| 3. B | Q1PE10 | F-box/kelch-repeat protein At4g39590 | 1.27e-04 | NA | 0.014 |
| 3. B | Q8RY71 | Epithiospecifier protein | 8.94e-11 | NA | 1.13e-05 |
| 3. B | Q0VCJ6 | Zinc finger and BTB domain-containing protein 8A | 4.58e-03 | NA | 4.50e-11 |
| 3. B | Q5NVK7 | Speckle-type POZ protein | 3.55e-07 | NA | 4.20e-05 |
| 3. B | Q0IHH9 | Speckle-type POZ protein B | 3.32e-07 | NA | 7.90e-05 |
| 3. B | Q3B725 | Zinc finger and BTB domain-containing protein 24 | 3.86e-01 | NA | 4.01e-04 |
| 3. B | Q5R866 | Kelch domain-containing protein 7A (Fragment) | 3.44e-06 | NA | 1.49e-05 |
| 3. B | P97303 | Transcription regulator protein BACH2 | 7.14e-02 | NA | 5.22e-05 |
| 3. B | G5E8B9 | Zinc finger and BTB domain-containing protein 11 | 1.05e-01 | NA | 2.72e-05 |
| 3. B | Q8IYD2 | Kelch domain-containing protein 8A | 3.15e-07 | NA | 1.67e-06 |
| 3. B | O22286 | BTB/POZ and MATH domain-containing protein 3 | 4.04e-04 | NA | 2.81e-05 |
| 3. B | Q9JKY3 | Zinc finger and BTB domain-containing protein 18 | 7.51e-01 | NA | 6.32e-04 |
| 3. B | Q9SDM9 | Nitrile-specifier protein 1 | 2.73e-05 | NA | 0.009 |
| 3. B | Q8BN78 | Transcriptional regulator Kaiso | 7.14e-04 | NA | 0.005 |
| 3. B | Q31T32 | N-acetylneuraminate epimerase | 1.78e-07 | NA | 0.025 |
| 3. B | O04318 | Nitrile-specifier protein 3 | 2.44e-05 | NA | 0.009 |
| 3. B | Q969K4 | Ankyrin repeat and BTB/POZ domain-containing protein 1 | 1.19e-03 | NA | 0.024 |
| 3. B | Q91XA8 | Kelch domain-containing protein 8A | 2.82e-07 | NA | 1.18e-06 |
| 3. B | Q8K2J9 | BTB/POZ domain-containing protein 6 | 4.14e-05 | NA | 4.10e-05 |
| 3. B | Q86UZ6 | Zinc finger and BTB domain-containing protein 46 | 2.30e-02 | NA | 3.90e-10 |
| 3. B | Q04652 | Ring canal kelch protein | NA | NA | 1.48e-46 |
| 3. B | O76612 | BTB and MATH domain-containing protein 47 | 9.29e-02 | NA | 0.014 |
| 3. B | Q9ULJ3 | Zinc finger and BTB domain-containing protein 21 | 2.83e-02 | NA | 6.27e-04 |
| 3. B | O43829 | Zinc finger and BTB domain-containing protein 14 | 8.05e-01 | NA | 4.26e-05 |
| 3. B | Q9D2D9 | Kelch domain-containing protein 8B | 4.33e-09 | NA | 1.01e-05 |
| 3. B | Q9QZ48 | Zinc finger and BTB domain-containing protein 7A | 8.08e-04 | NA | 2.40e-15 |
| 3. B | Q0D1P4 | Kelch-like protein terF | 5.19e-06 | NA | 1.39e-10 |
| 3. B | O82374 | Putative F-box/kelch-repeat protein At2g29820 | 1.20e-04 | NA | 0.008 |
| 3. B | Q2M2N2 | Speckle-type POZ protein-like | 5.30e-05 | NA | 2.42e-05 |
| 3. B | Q8IN81 | Sex determination protein fruitless | 1.63e-01 | NA | 1.72e-04 |
| 3. B | Q2LE78 | BTB/POZ domain-containing protein 6 | 1.76e-04 | NA | 3.52e-05 |
| 3. B | Q64321 | Zinc finger and BTB domain-containing protein 7B | 5.45e-01 | NA | 4.42e-06 |
| 3. B | O15062 | Zinc finger and BTB domain-containing protein 5 | 7.69e-03 | NA | 1.11e-06 |
| 3. B | Q24206 | Broad-complex core protein isoform 6 | 2.96e-02 | NA | 2.40e-06 |
| 3. B | Q5EXX3 | Zinc finger and BTB domain-containing protein 38 | 9.73e-01 | NA | 0.003 |
| 3. B | Q6NRS1 | Inhibitor of Bruton tyrosine kinase | 1.67e-01 | NA | 0.009 |
| 3. B | Q6A051 | Attractin-like protein 1 | 2.27e-05 | NA | 0.048 |
| 3. B | Q5NBY9 | POZ (BTB) and AT hook-containing zinc finger 1 | NA | NA | 3.90e-06 |
| 3. B | Q25390 | Alpha-scruin | 8.41e-05 | NA | 3.88e-09 |
| 3. B | Q80X44 | Zinc finger and BTB domain-containing protein 24 | 5.29e-01 | NA | 8.28e-05 |
| 3. B | Q6ZWS8 | Speckle-type POZ protein | 4.16e-07 | NA | 4.20e-05 |
| 3. B | Q5RCW7 | Kelch domain-containing protein 8B | 4.56e-09 | NA | 4.90e-05 |
| 3. B | P34371 | BTB and MATH domain-containing protein 42 | 5.43e-05 | NA | 3.37e-04 |
| 3. B | Q8N653 | Leucine-zipper-like transcriptional regulator 1 | 6.46e-05 | NA | 5.10e-04 |
| 3. B | Q8CII0 | Zinc finger and BTB domain-containing protein 8B | 1.31e-03 | NA | 6.47e-09 |
| 3. B | P41182 | B-cell lymphoma 6 protein | 6.27e-01 | NA | 6.25e-09 |
| 3. B | Q5XIA9 | Kelch domain-containing protein 8B | 4.65e-09 | NA | 1.03e-04 |
| 3. B | Q6GLJ1 | BTB/POZ domain-containing protein 17 | 1.13e-06 | NA | 0.001 |
| 3. B | Q8X554 | N-acetylneuraminate epimerase | 1.70e-10 | NA | 0.024 |
| 3. B | Q5R5N5 | Myoneurin | 5.82e-01 | NA | 6.24e-07 |
| 3. B | Q9V5M6 | Longitudinals lacking protein, isoforms J/P/Q/S/Z | 3.28e-02 | NA | 3.97e-04 |
| 3. B | Q96CT2 | Kelch-like protein 29 | 0.00e+00 | NA | 1.61e-43 |
| 3. B | Q8CVR2 | N-acetylneuraminate epimerase 1 | 2.02e-10 | NA | 5.69e-04 |
| 3. B | Q7KQZ4 | Longitudinals lacking protein, isoforms A/B/D/L | 1.44e-02 | NA | 4.29e-04 |
| 3. B | Q9FPW6 | BTB/POZ domain-containing protein POB1 | 7.79e-04 | NA | 1.85e-11 |
| 3. B | Q6DBN1 | BTB/POZ domain-containing protein At4g08455 | 1.79e-05 | NA | 4.90e-06 |
| 3. B | O82370 | Putative F-box/kelch-repeat protein At2g29860 | 9.05e-04 | NA | 0.042 |
| 3. B | Q9BX70 | BTB/POZ domain-containing protein 2 | 2.28e-04 | NA | 1.48e-07 |
| 3. B | A2APT9 | Kelch domain-containing protein 7A | 1.98e-06 | NA | 5.18e-05 |
| 3. B | Q5VV63 | Attractin-like protein 1 | 2.33e-02 | NA | 0.015 |
| 3. B | Q96KE9 | BTB/POZ domain-containing protein 6 | 1.03e-04 | NA | 2.29e-04 |
| 3. B | Q08605 | Transcription factor GAGA | 6.53e-01 | NA | 2.17e-05 |
| 3. B | O82373 | F-box/kelch-repeat protein At2g29830 | 6.26e-06 | NA | 6.65e-04 |
| 3. B | Q25386 | Beta-scruin | 1.60e-04 | NA | 1.73e-09 |
| 3. B | Q9W2S3 | BTB/POZ domain-containing protein 9 | 7.02e-05 | NA | 1.25e-10 |
| 3. B | Q1L8W0 | Zinc finger and BTB domain-containing protein 18 | 8.12e-01 | NA | 5.26e-04 |
| 3. B | Q58CV6 | Kelch domain-containing protein 3 | 1.73e-10 | NA | 0.024 |
| 3. B | Q9CAG8 | F-box/kelch-repeat protein At1g67480 | 9.83e-06 | NA | 1.95e-05 |
| 3. B | Q9DAI4 | Zinc finger and BTB domain-containing protein 43 | 5.27e-04 | NA | 1.08e-04 |
| 3. B | Q96BR9 | Zinc finger and BTB domain-containing protein 8A | 9.52e-03 | NA | 3.39e-11 |
| 3. B | Q8BID6 | Zinc finger and BTB domain-containing protein 46 | 2.35e-02 | NA | 4.75e-10 |
| 3. B | Q6NRM8 | Zinc finger and BTB domain-containing protein 18.3 | 6.60e-01 | NA | 0.003 |
| 3. B | Q99MD8 | Myoneurin | 2.83e-03 | NA | 6.25e-07 |
| 3. B | O95365 | Zinc finger and BTB domain-containing protein 7A | 6.83e-03 | NA | 4.42e-14 |
| 3. B | Q1H9T6 | Telomere zinc finger-associated protein | 6.46e-02 | NA | 2.79e-05 |
| 3. B | Q9CQ33 | Leucine-zipper-like transcriptional regulator 1 | 6.09e-05 | NA | 6.58e-04 |
| 3. B | Q8N143 | B-cell CLL/lymphoma 6 member B protein | 6.89e-01 | NA | 1.51e-04 |
| 3. B | B1WBU4 | Zinc finger and BTB domain-containing protein 8A | 5.58e-03 | NA | 3.22e-11 |
| 3. B | A8A834 | N-acetylneuraminate epimerase | 1.66e-10 | NA | 0.015 |
| 3. B | Q0P4X6 | Zinc finger and BTB domain-containing protein 44 | 3.78e-03 | NA | 1.67e-10 |
| 3. B | Q66KD0 | BTB/POZ domain-containing protein 17 | 2.41e-06 | NA | 7.78e-05 |
| 3. B | Q9V5M3 | Longitudinals lacking protein, isoforms N/O/W/X/Y | 2.45e-02 | NA | 3.63e-04 |
| 3. B | Q96PQ7 | Kelch-like protein 5 | 0.00e+00 | NA | 6.69e-55 |
| 3. B | Q7ZX06 | Speckle-type POZ protein A | 3.45e-07 | NA | 5.71e-05 |
| 3. B | Q9BYV9 | Transcription regulator protein BACH2 | 4.03e-02 | NA | 7.17e-05 |
| 3. B | B2RXF5 | Zinc finger and BTB domain-containing protein 42 | 7.68e-01 | NA | 1.00e-08 |
| 3. B | Q9Y2K1 | Zinc finger and BTB domain-containing protein 1 | 9.09e-01 | NA | 0.008 |
| 3. B | Q5ZM39 | B-cell lymphoma 6 protein homolog | 6.81e-01 | NA | 2.53e-08 |
| 3. B | Q8CDC7 | Zinc finger and BTB domain-containing protein 9 | 2.30e-05 | NA | 0.001 |
| 3. B | Q7ZWZ4 | Zinc finger and BTB domain-containing protein 18.2 | 5.77e-01 | NA | 1.17e-07 |
| 3. B | Q811H0 | Zinc finger and BTB domain-containing protein 42 | 6.77e-01 | NA | 3.18e-09 |
| 3. B | Q9H116 | GDNF-inducible zinc finger protein 1 | 4.44e-01 | NA | 0.036 |
| 3. B | A1L4W5 | BTB/POZ and MATH domain-containing protein 6 | 6.44e-04 | NA | 2.47e-07 |
| 3. B | P42284 | Longitudinals lacking protein, isoforms H/M/V | 5.12e-03 | NA | 3.83e-04 |
| 3. B | Q7TQG0 | Zinc finger and BTB domain-containing protein 5 | 8.45e-04 | NA | 1.24e-06 |
| 3. B | O04316 | Nitrile-specifier protein 4 | 8.90e-05 | NA | 0.034 |
| 3. B | Q01820 | Protein germ cell-less | 1.97e-03 | NA | 4.87e-05 |
| 3. B | Q96C00 | Zinc finger and BTB domain-containing protein 9 | 2.36e-05 | NA | 3.03e-04 |
| 3. B | O15060 | Zinc finger and BTB domain-containing protein 39 | 7.80e-01 | NA | 8.08e-05 |
| 3. B | O95625 | Zinc finger and BTB domain-containing protein 11 | 1.19e-01 | NA | 2.39e-05 |
| 3. B | Q52KG4 | Zinc finger and BTB domain-containing protein 45 | 6.59e-01 | NA | 0.024 |
| 3. B | Q9LQ95 | BTB/POZ domain-containing protein At1g01640 | 2.82e-06 | NA | 0.001 |
| 3. B | Q8NAP8 | Zinc finger and BTB domain-containing protein 8B | 5.58e-03 | NA | 9.62e-09 |
| 3. B | O14867 | Transcription regulator protein BACH1 | 9.57e-02 | NA | 2.29e-05 |
| 3. B | Q9SRV1 | BTB/POZ and MATH domain-containing protein 4 | 2.59e-04 | NA | 0.001 |
| 3. B | Q8L765 | BTB/POZ and MATH domain-containing protein 1 | 8.86e-05 | NA | 7.06e-06 |
| 3. B | Q9W0K7 | Protein bric-a-brac 1 | 6.91e-02 | NA | 0.004 |
| 3. B | Q6PID8 | Kelch domain-containing protein 10 | 1.20e-08 | NA | 2.71e-04 |
| 3. B | O43298 | Zinc finger and BTB domain-containing protein 43 | 8.19e-04 | NA | 2.76e-04 |
| 3. B | Q96DT7 | Zinc finger and BTB domain-containing protein 10 | 4.19e-02 | NA | 4.67e-08 |
| 3. B | O04615 | BTB/POZ domain-containing protein At4g01160 | 3.17e-03 | NA | 5.14e-05 |
| 3. B | Q9M8J9 | BTB/POZ and MATH domain-containing protein 2 | 4.81e-04 | NA | 5.73e-04 |
| 3. B | Q05516 | Zinc finger and BTB domain-containing protein 16 | 7.64e-01 | NA | 3.81e-05 |
| 3. B | Q9VQ30 | Zinc finger protein chinmo | 3.35e-03 | NA | 0.011 |
| 3. B | P34568 | BTB and MATH domain-containing protein 43 | 1.50e-06 | NA | 0.017 |
| 3. B | Q91VL9 | Zinc finger and BTB domain-containing protein 1 | 9.50e-01 | NA | 0.007 |
| 3. B | Q9H5J0 | Zinc finger and BTB domain-containing protein 3 | 2.63e-03 | NA | 1.72e-06 |
| 3. B | Q6YCH2 | TD and POZ domain-containing protein 4 | 2.57e-05 | NA | 0.050 |
| 3. B | A0JMG1 | Speckle-type POZ protein-like B | 4.86e-05 | NA | 3.80e-04 |
| 3. B | P50090 | Kelch repeat-containing protein 2 | 1.49e-03 | NA | 7.27e-05 |
| 3. B | A9JRD8 | BTB/POZ domain-containing protein 6-A | 7.66e-05 | NA | 3.89e-05 |
| 3. B | Q6GR09 | Speckle-type POZ protein-like | 7.87e-05 | NA | 3.38e-05 |
| 3. B | P97302 | Transcription regulator protein BACH1 | 5.35e-02 | NA | 1.35e-05 |
| 3. B | Q9W0K4 | Protein bric-a-brac 2 | 3.01e-02 | NA | 2.59e-05 |
| 3. B | P24278 | Zinc finger and BTB domain-containing protein 25 | 1.29e-03 | NA | 8.08e-04 |
| 3. B | Q5BL35 | Speckle-type POZ protein-like A | 6.46e-05 | NA | 6.63e-05 |
| 3. B | Q8L736 | F-box/kelch-repeat protein SKIP11 | 2.30e-05 | NA | 0.038 |
| 3. B | A1YPR0 | Zinc finger and BTB domain-containing protein 7C | 1.28e-03 | NA | 4.93e-08 |
| 3. B | Q7ZVR6 | Myoneurin | 2.35e-01 | NA | 9.83e-05 |
| 3. B | Q6ZPR6 | Inhibitor of Bruton tyrosine kinase | 1.09e-01 | NA | 0.008 |
| 3. B | Q0SXL5 | N-acetylneuraminate epimerase | 1.93e-10 | NA | 0.031 |
| 3. B | Q9C6Z0 | F-box/kelch-repeat protein At1g30090 | 1.32e-05 | NA | 0.005 |
| 3. B | Q9HC78 | Zinc finger and BTB domain-containing protein 20 | 8.85e-01 | NA | 6.55e-05 |
| 3. B | P10074 | Telomere zinc finger-associated protein | 2.46e-02 | NA | 7.44e-06 |
| 3. B | Q8S8F2 | BTB/POZ domain-containing protein FBL11 | 1.85e-02 | NA | 0.005 |
| 3. B | Q9Y330 | Zinc finger and BTB domain-containing protein 12 | 8.24e-01 | NA | 7.65e-04 |
| 3. B | Q9SJ85 | BTB/POZ domain-containing protein At2g04740 | 1.12e-03 | NA | 0.013 |
| 3. B | Q96K62 | Zinc finger and BTB domain-containing protein 45 | 1.29e-02 | NA | 0.037 |
| 3. B | Q5R633 | Telomere zinc finger-associated protein | 4.38e-01 | NA | 7.84e-06 |
| 3. B | P42283 | Longitudinals lacking protein, isoform G | 2.03e-02 | NA | 4.59e-04 |
| 3. B | Q9UFB7 | Zinc finger and BTB domain-containing protein 47 | 8.10e-01 | NA | 2.55e-08 |
| 3. B | Q96RE7 | Nucleus accumbens-associated protein 1 | 9.54e-04 | NA | 0.008 |
| 3. B | Q5TZE1 | BTB/POZ domain-containing protein 6-B | 9.82e-05 | NA | 9.48e-07 |
| 3. B | Q83IN1 | N-acetylneuraminate epimerase | 2.08e-10 | NA | 0.031 |
| 3. B | P41183 | B-cell lymphoma 6 protein homolog | 6.22e-01 | NA | 3.92e-09 |
| 3. B | P34324 | BTB and MATH domain-containing protein 15 (Fragment) | 5.07e-05 | NA | 1.32e-04 |
| 3. B | Q8NCP5 | Zinc finger and BTB domain-containing protein 44 | 1.43e-03 | NA | 8.42e-09 |
| 3. B | Q6PAR0 | Kelch domain-containing protein 10 | 7.05e-09 | NA | 0.001 |
| 3. B | B9DHT4 | ARM REPEAT PROTEIN INTERACTING WITH ABF2 | 1.38e-03 | NA | 1.76e-06 |
| 3. B | Q8NAP3 | Zinc finger and BTB domain-containing protein 38 | 9.88e-01 | NA | 0.005 |
| 3. B | P0C7A6 | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-B | 3.51e-02 | NA | 2.98e-04 |
| 3. B | Q0VCW1 | Speckle-type POZ protein | 3.44e-07 | NA | 4.20e-05 |
| 3. B | Q8BXX2 | Zinc finger and BTB domain-containing protein 49 | 6.84e-01 | NA | 3.14e-11 |
| 3. B | Q91X45 | Zinc finger and BTB domain-containing protein 3 | 3.70e-03 | NA | 8.64e-06 |
| 3. B | Q9XWB9 | BTB and MATH domain-containing protein 36 | 7.30e-06 | NA | 1.37e-04 |
| 3. B | Q9ZW38 | F-box/kelch-repeat protein At2g29600 | 2.09e-04 | NA | 0.004 |
| 3. B | A0JN76 | Zinc finger and BTB domain-containing protein 18 | 3.74e-01 | NA | 6.78e-04 |
| 3. B | Q8VCZ7 | Zinc finger and BTB domain-containing protein 7C | 1.69e-03 | NA | 2.58e-08 |
| 3. B | Q9NPC7 | Myoneurin | 2.61e-03 | NA | 6.25e-07 |
| 3. B | P0C2F7 | Kelch repeat-containing protein At1g19470 | 4.99e-04 | NA | 0.009 |
| 3. B | Q8N680 | Zinc finger and BTB domain-containing protein 2 | 5.60e-01 | NA | 0.015 |
| 3. B | O43167 | Zinc finger and BTB domain-containing protein 24 | 6.66e-01 | NA | 4.87e-04 |
| 3. B | Q6NPN5 | F-box/kelch-repeat protein At5g26960 | 9.44e-07 | NA | 0.002 |
| 3. B | Q5U3Y0 | Kelch domain-containing protein 10 | 5.74e-09 | NA | 0.001 |
| 3. B | Q6DDV0 | Myoneurin | 1.80e-01 | NA | 5.21e-07 |
| 3. B | Q867Z4 | Longitudinals lacking protein, isoforms F/I/K/T | 2.80e-02 | NA | 3.56e-04 |
| 3. B | Q9H0C5 | BTB/POZ domain-containing protein 1 | 3.92e-06 | NA | 5.51e-08 |
| 3. B | Q6GQW0 | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11 | 2.65e-02 | NA | 7.85e-07 |
| 3. B | Q01295 | Broad-complex core protein isoforms 1/2/3/4/5 | 9.17e-02 | NA | 2.67e-06 |
| 3. B | Q5E9V5 | Kelch domain-containing protein 8B | 2.64e-09 | NA | 4.33e-05 |
| 3. B | O82343 | BTB/POZ domain-containing protein At2g46260 | 1.84e-03 | NA | 6.42e-11 |
| 3. B | Q801P1 | Zinc finger and BTB domain-containing protein 18 | 6.78e-01 | NA | 0.002 |
| 3. B | P42282 | Protein tramtrack, alpha isoform | 1.58e-02 | NA | 1.59e-04 |
| 3. B | Q6P882 | Zinc finger and BTB domain-containing protein 8A.2 | 4.78e-03 | NA | 2.29e-09 |
| 3. B | P58544 | BTB/POZ domain-containing protein 1 | 1.91e-05 | NA | 5.06e-08 |
| 3. B | Q9HBE1 | POZ-, AT hook-, and zinc finger-containing protein 1 | 9.12e-01 | NA | 3.97e-06 |
| 3. B | P41886 | BTB and MATH domain-containing protein 41 | 2.05e-04 | NA | 0.036 |
| 3. B | Q8R0A2 | Zinc finger and BTB domain-containing protein 44 | 8.20e-04 | NA | 7.37e-09 |
| 3. B | Q9JKD9 | Zinc finger and BTB domain-containing protein 32 | 5.31e-03 | NA | 9.38e-05 |
| 3. B | P14083 | Protein jim lovell | 1.47e-02 | NA | 0.002 |
| 3. B | Q9XHZ8 | BTB/POZ domain-containing protein At1g21780 | 9.51e-08 | NA | 4.67e-04 |
| 3. B | Q5XKL5 | BTB/POZ domain-containing protein 8 | 4.45e-07 | NA | 8.34e-05 |
| 3. B | Q8UVQ4 | Transcriptional regulator Kaiso | 9.99e-03 | NA | 0.028 |
| 3. B | A1L2U9 | Zinc finger and BTB domain-containing protein 8A.1-B | 5.30e-03 | NA | 1.78e-09 |
| 3. B | O08764 | Ankyrin repeat and BTB/POZ domain-containing protein 2 | 2.47e-02 | NA | 0.003 |
| 3. B | Q7T330 | Speckle-type POZ protein | 3.46e-07 | NA | 2.33e-05 |
| 3. B | Q973G3 | Kelch domain-containing protein STK_09390 | 2.77e-08 | NA | 0.042 |
| 3. B | B7U179 | ARMADILLO BTB ARABIDOPSIS PROTEIN 1 | 1.88e-03 | NA | 8.95e-04 |
| 3. B | Q9LM55 | F-box/kelch-repeat protein At1g22040 | 7.09e-04 | NA | 4.68e-04 |
| 3. B | Q0IIC2 | Kelch domain-containing protein 10 | 1.60e-06 | NA | 2.59e-04 |
| 3. B | Q94420 | Protein maternal effect lethal 26 | 2.73e-04 | NA | 0.004 |
| 3. B | P17789 | Protein tramtrack, beta isoform | 8.55e-03 | NA | 1.02e-04 |
| 3. B | Q9M1W7 | F-box/kelch-repeat protein SKIP30 | 8.98e-07 | NA | 9.71e-07 |
| 3. B | O15156 | Zinc finger and BTB domain-containing protein 7B | 5.05e-01 | NA | 3.08e-06 |
| 3. B | A1YEX3 | Zinc finger and BTB domain-containing protein 25 | 7.12e-03 | NA | 8.08e-04 |
| 3. B | Q7KRI2 | Longitudinals lacking protein-like | 8.22e-05 | NA | 1.50e-05 |
| 3. B | Q99592 | Zinc finger and BTB domain-containing protein 18 | 6.11e-01 | NA | 6.84e-04 |
| 3. B | Q0WW40 | F-box/kelch-repeat protein At1g16250 | 2.48e-06 | NA | 8.81e-09 |
| 3. B | Q8H4D4 | tRNA wybutosine-synthesizing protein 2/3/4 | 1.11e-02 | NA | 0.047 |
| 3. B | O93567 | Zinc finger and BTB domain-containing protein 7A | 5.45e-02 | NA | 2.46e-14 |
| 3. B | Q19981 | Putative protein tag-53 | 2.10e-05 | NA | 0.007 |
| 3. B | Q8IXV7 | Kelch domain-containing protein 8B | 5.00e-09 | NA | 5.49e-05 |
| 3. B | P17367 | Protein C5 | NA | NA | 4.21e-05 |
| 3. B | Q0IH98 | Zinc finger and BTB domain-containing protein 8A.1-A | 5.79e-03 | NA | 1.22e-09 |
| 3. B | Q9BQ90 | Kelch domain-containing protein 3 | 1.59e-10 | NA | 0.009 |
| 3. B | Q94BN0 | BTB/POZ and TAZ domain-containing protein 2 | 6.16e-04 | NA | 2.09e-05 |
| 3. B | Q6IQ16 | Speckle-type POZ protein-like | 2.38e-05 | NA | 4.61e-04 |
| 3. B | Q52KB5 | Zinc finger and BTB domain-containing protein 24 | 8.72e-01 | NA | 9.72e-05 |
| 3. B | Q8LEV3 | BTB/POZ domain-containing protein At2g30600 | 3.53e-04 | NA | 1.22e-07 |
| 3. B | D3YUB6 | BTB/POZ domain-containing protein 8 | 2.71e-07 | NA | 0.001 |
| 3. B | O88939 | Zinc finger and BTB domain-containing protein 7A | 2.01e-02 | NA | 2.40e-15 |
| 3. B | Q86B87 | Modifier of mdg4 | 6.61e-03 | NA | 3.01e-04 |
| 3. B | Q5TC79 | Zinc finger and BTB domain-containing protein 37 | 1.01e-03 | NA | 1.22e-05 |
| 3. B | Q9VFP2 | Protein roadkill | 1.94e-03 | NA | 0.026 |
| 3. B | B1WBS3 | Zinc finger and BTB domain-containing protein 42 | 4.50e-01 | NA | 9.47e-09 |
| 3. B | Q54D84 | Trishanku | 1.88e-03 | NA | 7.55e-05 |
| 3. B | Q13105 | Zinc finger and BTB domain-containing protein 17 | 2.16e-02 | NA | 1.01e-11 |
| 3. B | Q5R4Q7 | Leucine-zipper-like transcriptional regulator 1 | 6.31e-05 | NA | 7.56e-04 |
| 3. B | Q9SJ04 | F-box/kelch-repeat protein SKIP6 | 8.00e-05 | NA | 0.025 |
| 3. B | Q28DE7 | Kelch domain-containing protein 10 | 1.37e-06 | NA | 0.020 |
| 3. B | Q70JS2 | Ring canal kelch homolog | NA | NA | 4.86e-60 |
| 3. B | Q8K0L9 | Zinc finger and BTB domain-containing protein 20 | 8.69e-01 | NA | 6.12e-05 |
| 3. B | Q3B7N9 | Myoneurin | 2.07e-01 | NA | 6.51e-07 |
| 3. B | Q9P2D0 | Inhibitor of Bruton tyrosine kinase | 2.29e-01 | NA | 3.88e-04 |
| 3. B | Q680K8 | BTB/POZ domain-containing protein At1g55760 | 1.10e-07 | NA | 0.001 |
| 3. B | Q3SWU4 | Zinc finger and BTB domain-containing protein 44 | 7.03e-04 | NA | 9.84e-09 |
| 3. B | Q9WUK6 | Zinc finger and BTB domain-containing protein 18 | 4.20e-01 | NA | 6.55e-04 |
| 3. B | Q80T74 | Kelch-like protein 29 | 0.00e+00 | NA | 2.41e-43 |
| 3. B | B2RXH4 | BTB/POZ domain-containing protein 18 | 1.84e-03 | NA | 0.003 |
| 3. B | Q9LYL9 | BTB/POZ domain-containing protein At3g56230 | 1.11e-05 | NA | 0.005 |