Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q7JQ07
(Mariner Mos1 transposase) with a FATCAT P-Value: 3.08e-06 and RMSD of 2.54 angstrom. The sequence alignment identity is 21.7%.
Structural alignment shown in left. Query protein Q3ZCU0 colored as red in alignment, homolog Q7JQ07 colored as blue.
Query protein Q3ZCU0 is also shown in right top, homolog Q7JQ07 showed in right bottom. They are colored based on secondary structures.
Q3ZCU0 MSDRYL---EQ-RISIKFCVKLNKSASETHHLLKEAYGDEV--MSRA-RVFDWHKRFKEGREDVRDDARSGRPVTHRTDD-NIQKVKDLVCSNRQLTVRM 92 Q7JQ07 MSS-FVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKKCER---WFQRFKSGDFDV-DDKEHGKP-PKRYEDAELQALLD--EDDAQ-TQKQ 91 Q3ZCU0 MAEELNLDKETV--RLILKENLNMRKISAKVISGVLKETEPHYVAQAGL-------ELLVSRDPPTLASQSSGIISMSHHAKPKPG-VQWCKFQSESTGR 182 Q7JQ07 LAEQLEVSQQAVSNR--LRE---MGKIQ-KV--G---RWVPHELNERQMERRKNTCEILLSR------YKRKSFL---HRI--VTGDEKWIFFVSP---K 166 Q3ZCU0 RARS-ADVQGQEKMDVTAQEARTNLPFYLFVLF-RSSM---NWMMSMHIREGCLF---ITRS-T-NS--------NAN--LFRKHP------HR------ 250 Q7JQ07 RKKSYVD-PGQ---PATST-ARPN-------RFGKKTMLCVWWDQS-----GVIYYELLKRGETVNTARYQQQLINLNRALQRKRPEYQKRQHRVIFLHD 249 Q3ZCU0 ----HTQK---------------------------------------------------------------------------------------- 254 Q7JQ07 NAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYLE 345
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0015074 | DNA integration |
| 1. PB | GO:0004519 | endonuclease activity |
| 2. P | GO:0006310 | DNA recombination |
| 3. B | GO:0051213 | dioxygenase activity |
| 3. B | GO:0090305 | nucleic acid phosphodiester bond hydrolysis |
| 3. B | GO:0097676 | histone H3-K36 dimethylation |
| 3. B | GO:0000151 | ubiquitin ligase complex |
| 3. B | GO:0030175 | filopodium |
| 3. B | GO:0033634 | positive regulation of cell-cell adhesion mediated by integrin |
| 3. B | GO:0044774 | mitotic DNA integrity checkpoint signaling |
| 3. B | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding |
| 3. B | GO:0070062 | extracellular exosome |
| 3. B | GO:0031528 | microvillus membrane |
| 3. B | GO:0042800 | histone methyltransferase activity (H3-K4 specific) |
| 3. B | GO:0102751 | UDP-alpha-D-glucose:glucosyl-glycogenin alpha-D-glucosyltransferase activity |
| 3. B | GO:0000981 | DNA-binding transcription factor activity, RNA polymerase II-specific |
| 3. B | GO:0072015 | glomerular visceral epithelial cell development |
| 3. B | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:1901215 | negative regulation of neuron death |
| 3. B | GO:0000737 | DNA catabolic process, endonucleolytic |
| 3. B | GO:0022408 | negative regulation of cell-cell adhesion |
| 3. B | GO:0034451 | centriolar satellite |
| 3. B | GO:0051568 | histone H3-K4 methylation |
| 3. B | GO:0031297 | replication fork processing |
| 3. B | GO:0031490 | chromatin DNA binding |
| 3. B | GO:2001034 | positive regulation of double-strand break repair via nonhomologous end joining |
| 3. B | GO:0036057 | slit diaphragm |
| 3. B | GO:0035861 | site of double-strand break |
| 3. B | GO:0044547 | DNA topoisomerase binding |
| 3. B | GO:0044666 | MLL3/4 complex |
| 3. B | GO:0071558 | histone H3-tri/di-methyl-lysine-27 demethylase activity |
| 3. B | GO:0007162 | negative regulation of cell adhesion |
| 3. B | GO:0006303 | double-strand break repair via nonhomologous end joining |
| 3. B | GO:0043947 | obsolete positive regulation by host of symbiont catalytic activity |
| 3. B | GO:0005634 | nucleus |
| 3. B | GO:0034097 | response to cytokine |
| 3. B | GO:0000014 | single-stranded DNA endodeoxyribonuclease activity |
| 3. B | GO:2001251 | negative regulation of chromosome organization |
| 3. B | GO:0032688 | negative regulation of interferon-beta production |
| 3. B | GO:0031647 | regulation of protein stability |
| 3. B | GO:0046975 | histone methyltransferase activity (H3-K36 specific) |
| 3. B | GO:0072175 | epithelial tube formation |
| 3. B | GO:0008466 | glycogenin glucosyltransferase activity |
| 3. B | GO:0010452 | histone H3-K36 methylation |
| 3. B | GO:2000373 | positive regulation of DNA topoisomerase (ATP-hydrolyzing) activity |
| 3. B | GO:0032534 | regulation of microvillus assembly |
| 3. B | GO:0038061 | NIK/NF-kappaB signaling |
| 3. B | GO:0000729 | DNA double-strand break processing |
| 3. B | GO:0001726 | ruffle |
| 3. B | GO:0071557 | histone H3-K27 demethylation |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q7JQ07 | Mariner Mos1 transposase | 3.08e-06 | 2.01e-02 | 3.77e-09 |
| 1. PB | Q3ZCU0 | Protein GVQW3 | 0 | 1.04e-163 | 0.0 |
| 3. B | O00592 | Podocalyxin | 6.34e-01 | NA | 2.99e-04 |
| 3. B | Q5SR53 | Putative uncharacterized protein PIK3CD-AS1 | 1.64e-01 | NA | 0.005 |
| 3. B | Q04864 | Proto-oncogene c-Rel | 6.47e-01 | NA | 1.18e-04 |
| 3. B | Q8N2A0 | Putative uncharacterized protein encoded by LINC00269 | 4.52e-01 | NA | 2.77e-07 |
| 3. B | Q6ZUF6 | Putative uncharacterized protein encoded by LINC00336 | 1.91e-01 | NA | 0.001 |
| 3. B | Q9Y2Z0 | Protein SGT1 homolog | 3.46e-01 | NA | 0.002 |
| 3. B | Q9P281 | BAH and coiled-coil domain-containing protein 1 | 9.99e-01 | NA | 0.019 |
| 3. B | Q6B4Z3 | Histone demethylase UTY | 4.94e-01 | NA | 0.029 |
| 3. B | Q53H47 | Histone-lysine N-methyltransferase SETMAR | 3.85e-04 | NA | 6.59e-06 |
| 3. B | Q8N976 | Putative uncharacterized protein FLJ38264 | 3.96e-01 | NA | 1.58e-08 |
| 3. B | O15488 | Glycogenin-2 | 7.33e-01 | NA | 0.031 |
| 3. B | Q9H2J1 | Uncharacterized protein ARRDC1-AS1 | 1.76e-01 | NA | 7.12e-07 |
| 3. B | Q8N769 | Uncharacterized protein C14orf178 | 7.34e-01 | NA | 8.60e-07 |
| 3. B | Q8WTZ3 | Zinc finger protein ENSP00000375192 | 5.33e-01 | NA | 0.001 |
| 3. B | O14628 | Zinc finger protein 195 | 8.45e-01 | NA | 0.004 |
| 3. B | Q6UX73 | UPF0764 protein C16orf89 | 1.77e-01 | NA | 4.11e-05 |
| 3. B | Q9NV72 | Zinc finger protein 701 | 4.24e-01 | NA | 0.001 |