Summary

Q3ZM63

Homolog: A0A1B0GVM5.
Function: Embryonic testis differentiation protein homolog C.

Statistics

Total GO Annotation: 12
Unique PROST Go: 12
Unique BLAST Go: 0

Total Homologs: 17
Unique PROST Homologs: 13
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A0A1B0GVM5 (Embryonic testis differentiation protein homolog C) with a FATCAT P-Value: 9.27e-07 and RMSD of 3.27 angstrom. The sequence alignment identity is 78.0%.
Structural alignment shown in left. Query protein Q3ZM63 colored as red in alignment, homolog A0A1B0GVM5 colored as blue. Query protein Q3ZM63 is also shown in right top, homolog A0A1B0GVM5 showed in right bottom. They are colored based on secondary structures. 

      Q3ZM63 MDKEVPKGSPREPALNIKKSDKSFKRKKPTENVLIFLINRQLGRHRSDIDLSRWVWMLS 59
  A0A1B0GVM5 MDKELPKASPSEPALNIKKSGKSFKCKKPTKNVQVFLINRQLGRNRSDTDLSKWLWMLP 59

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0000772 mating pheromone activity
2. P GO:0044659 viral release from host cell by cytolysis
2. P GO:0048367 shoot system development
2. P GO:0019835 cytolysis
2. P GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
2. P GO:0005576 extracellular region
2. P GO:0008285 negative regulation of cell population proliferation
2. P GO:0005179 hormone activity
2. P GO:0090437 socket cell differentiation
2. P GO:0006113 fermentation
2. P GO:0097746 blood vessel diameter maintenance
2. P GO:0008217 regulation of blood pressure

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q80SW5 Embryonic testis differentiation protein 4.28e-04 8.08e-14 1.67e-09
1. PB P0DPP9 Embryonic testis differentiation protein homolog B 3.83e-06 3.81e-165 4.47e-37
1. PB Q3ZM63 Embryonic testis differentiation protein homolog A 0 3.81e-165 4.47e-37
1. PB A0A1B0GVM5 Embryonic testis differentiation protein homolog C 9.27e-07 2.22e-35 6.75e-28
2. P Q54KS5 Putative uncharacterized protein DDB_G0287145 1.51e-01 1.46e-02 NA
2. P Q3E806 Uncharacterized protein YOR316C-A 5.17e-01 2.28e-02 NA
2. P A0A6M3Z554 U11-myrmicitoxin-Tb1a (Fragment) 1.10e-01 4.90e-02 NA
2. P Q8TGT3 Uncharacterized protein YJL077W-B 1.51e-01 3.59e-02 NA
2. P P21857 Urotensin-2 (Fragments) 7.86e-02 9.06e-03 NA
2. P Q54C51 Putative uncharacterized protein DDB_G0293256 1.81e-01 8.87e-03 NA
2. P P34166 Mating hormone A-factor 2 3.88e-01 3.42e-03 NA
2. P Q12225 Putative uncharacterized protein YOR225W 1.31e-01 4.72e-02 NA
2. P Q6IM89 Small polypeptide DEVIL 12 1.08e-01 1.25e-05 NA
2. P P08230 Lysis protein (Fragment) NA 3.28e-03 NA
2. P Q6X5V0 Small polypeptide DEVIL 1 3.98e-01 2.60e-02 NA
2. P P40588 Putative uncharacterized protein YIR044C 4.99e-01 6.20e-03 NA
2. P P0DP16 Contryphan-C (Fragment) 8.51e-02 1.69e-02 NA