Summary

Q495Z4

Homolog: Q9NV39.
Function: Proline-rich protein 34.

Statistics

Total GO Annotation: 12
Unique PROST Go: 9
Unique BLAST Go: 3

Total Homologs: 13
Unique PROST Homologs: 11
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q9NV39 (Proline-rich protein 34) with a FATCAT P-Value: 0.0141 and RMSD of 3.47 angstrom. The sequence alignment identity is 24.1%.
Structural alignment shown in left. Query protein Q495Z4 colored as red in alignment, homolog Q9NV39 colored as blue. Query protein Q495Z4 is also shown in right top, homolog Q9NV39 showed in right bottom. They are colored based on secondary structures. 

  Q495Z4 MSGPPSAPQGALAAPRSPAVRRKGLQAPSWGSPGRPAAHSPWACGPPHWGPQRGPRNAAAARPGPRSRWHKRCAAACGACARPP---GHQLQPPG-AGAP 96
  Q9NV39 -----------------------------------------------------MPASATAA-------WH--CPPLC----LPPLPASAPTSPPNPATRP 34

  Q495Z4 QPGVACSYLGP-RPQRTPCSAQSRP--G----WCAG--PR-----RRHAPGTEPHV-APGRAPPP--RA--GASPGSRLLPGSPSLLLPAATWRTWGQES 177
  Q9NV39 AP-------GPGRRARCPQSAHPAPTRGALTFWAPGSWPRVLLVPR--SPG--PVLRAP-RLPHPAARARRRAWHGAR-LPGS-----PARAGRTF-Q-- 113

  Q495Z4 KVLRKIL-KAW-------DPFSLL---- 193
  Q9NV39 ---RGLVSNSWAHAIFLPRPPNVLELQV 138

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
2. P GO:0006915 apoptotic process
2. P GO:0090200 positive regulation of release of cytochrome c from mitochondria
2. P GO:0097194 execution phase of apoptosis
2. P GO:0070059 intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
2. P GO:2001244 positive regulation of intrinsic apoptotic signaling pathway
2. P GO:1900740 positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
2. P GO:0051117 ATPase binding
2. P GO:0001836 release of cytochrome c from mitochondria
3. B GO:0003743 translation initiation factor activity
3. B GO:0005525 GTP binding
3. B GO:0003924 GTPase activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q495Z4 Putative uncharacterized protein ASB16-AS1 0 2.28e-135 3.64e-126
2. P Q9NV39 Proline-rich protein 34 1.41e-02 9.48e-04 NA
2. P Q8NI28 Putative uncharacterized protein encoded by LINC01006 2.64e-01 2.25e-03 NA
2. P Q96M85 Putative uncharacterized protein FLJ32756 7.17e-01 1.57e-02 NA
2. P P0C879 Putative uncharacterized protein FLJ43185 1.71e-01 7.88e-03 NA
2. P Q8WZB0 Putative uncharacterized protein encoded by LINC00476 6.01e-01 3.90e-02 NA
2. P Q71F78 Putative lung carcinoma-associated protein 10 5.98e-02 2.15e-04 NA
2. P Q96PG8 Bcl-2-binding component 3, isoforms 3/4 6.37e-02 9.48e-03 NA
2. P Q96NR7 Putative uncharacterized protein WWC2-AS2 7.80e-03 1.57e-03 NA
2. P Q5T036 Uncharacterized protein FAM120AOS 2.42e-01 1.24e-02 NA
2. P P16828 Uncharacterized protein UL107 NA 1.47e-02 NA
2. P P0C7V0 Putative uncharacterized protein encoded by LINC00271 1.86e-01 2.61e-04 NA
3. B A1R516 Translation initiation factor IF-2 9.75e-01 NA 0.016