Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
P25407
(STI1-like protein (Fragment)) with a FATCAT P-Value: 1.13e-07 and RMSD of 2.51 angstrom. The sequence alignment identity is 10.5%.
Structural alignment shown in left. Query protein Q49AM3 colored as red in alignment, homolog P25407 colored as blue.
Query protein Q49AM3 is also shown in right top, homolog P25407 showed in right bottom. They are colored based on secondary structures.
Q49AM3 MAPIPKTVGRIKLDCSLRPSCPLEVAAAPKLCKEFGPEDYGEEDIVDFLRRLVESDPQGLHRIHVDGSSGRLQLWHHDYLLGHLDDEGKSTGQSDRGKGA 100 P25407 ---------------------------------------------------------------------------------------------------- 0 Q49AM3 EGLGTYCGLRKSFLYPPQESEPCPQSPSASATFPSVSDSLLQVAMPQKLLVTEEEANRLAEELVAEEERMKQKAEKKRLKKKRQKERKRQERLEQYCGEP 200 P25407 ---------------------------------------------------------------------------------------------------- 0 Q49AM3 KASTTSDGDESPPSSPGNPVQGQCGEEEDSLDLSSTFVSLALRKVGDWPLSARREKGLNQEPQGRGLALQKMGQEEESPPREERPQQSPKVQASPGLLAA 300 P25407 ---------------------------------------------------------------------------------------------------- 0 Q49AM3 ALQ--QSQELAKLGTSFAQNGFYHEAVVLFTQALKLNPQDHRLFGNRSFCHERLGQPAW-ALADAQVALTLRPGWPRGLFRLGKALMGLQRFREAAAVFQ 397 P25407 MVNKEEAQRLKELGNKCFQEGKYEEAVKYFSDAITNDPLDHVLYSNLSGAFASLGR-FYEALESANKCISIKKDWPKGYIRKGCAEHGLRQLSNAEKTYL 99 Q49AM3 ETLR----GGSQPDAARELR--SCL----L--HLT--LQGQRGGICAPPL-SPGALQP-LPHAELAPSGLPSLRCPRSTALRS-P-GLSPLLHYPSCHRS 479 P25407 EGLKIDPNNKSLQDALSKVRNENMLENAQLIAHLNNIIEND------PQLKSYKEENSNYPH-EL----LNTIK-----SINSNPMNIRIIL--STC--- 178 Q49AM3 HPNQPLSQTQSRRPHPLKPQDPSK--GWDILGLGLQHLSQAR------------------------------------------------ 519 P25407 HPK--ISE-------GVE-----KFFGFKFTGEG-ND-AEERQRQQREEEERRKKKEEEERKKKEEEEMKKQNRTPEQIQGDEHKLKVMN 252
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0050905 | neuromuscular process |
| 1. PB | GO:0001764 | neuron migration |
| 1. PB | GO:0045046 | protein import into peroxisome membrane |
| 1. PB | GO:0021895 | cerebral cortex neuron differentiation |
| 1. PB | GO:0005778 | peroxisomal membrane |
| 1. PB | GO:0009617 | response to bacterium |
| 1. PB | GO:0040018 | positive regulation of multicellular organism growth |
| 1. PB | GO:0140311 | protein sequestering activity |
| 1. PB | GO:0016561 | protein import into peroxisome matrix, translocation |
| 1. PB | GO:0044255 | cellular lipid metabolic process |
| 1. PB | GO:0043949 | regulation of cAMP-mediated signaling |
| 1. PB | GO:0072380 | TRC complex |
| 1. PB | GO:0005782 | peroxisomal matrix |
| 1. PB | GO:0005052 | peroxisome matrix targeting signal-1 binding |
| 1. PB | GO:0006635 | fatty acid beta-oxidation |
| 1. PB | GO:0043235 | receptor complex |
| 1. PB | GO:0008022 | protein C-terminus binding |
| 1. PB | GO:0005794 | Golgi apparatus |
| 1. PB | GO:0021795 | cerebral cortex cell migration |
| 1. PB | GO:0006625 | protein targeting to peroxisome |
| 1. PB | GO:0005777 | peroxisome |
| 1. PB | GO:0007029 | endoplasmic reticulum organization |
| 1. PB | GO:0033328 | peroxisome membrane targeting sequence binding |
| 1. PB | GO:0031267 | small GTPase binding |
| 1. PB | GO:0061077 | chaperone-mediated protein folding |
| 1. PB | GO:1903646 | positive regulation of chaperone-mediated protein folding |
| 1. PB | GO:0000268 | peroxisome targeting sequence binding |
| 1. PB | GO:0051461 | positive regulation of corticotropin secretion |
| 1. PB | GO:0051262 | protein tetramerization |
| 1. PB | GO:0032991 | protein-containing complex |
| 1. PB | GO:0016560 | protein import into peroxisome matrix, docking |
| 1. PB | GO:0048468 | cell development |
| 1. PB | GO:0005829 | cytosol |
| 1. PB | GO:0047485 | protein N-terminus binding |
| 1. PB | GO:0031072 | heat shock protein binding |
| 1. PB | GO:0000038 | very long-chain fatty acid metabolic process |
| 1. PB | GO:0045185 | maintenance of protein location |
| 1. PB | GO:0007006 | mitochondrial membrane organization |
| 1. PB | GO:0007031 | peroxisome organization |
| 1. PB | GO:0051286 | cell tip |
| 1. PB | GO:0006620 | posttranslational protein targeting to endoplasmic reticulum membrane |
| 1. PB | GO:0017071 | intracellular cyclic nucleotide activated cation channel complex |
| 1. PB | GO:0005221 | intracellular cyclic nucleotide activated cation channel activity |
| 1. PB | GO:0005528 | FK506 binding |
| 1. PB | GO:0031333 | negative regulation of protein-containing complex assembly |
| 1. PB | GO:0045055 | regulated exocytosis |
| 1. PB | GO:0016558 | protein import into peroxisome matrix |
| 1. PB | GO:0030674 | protein-macromolecule adaptor activity |
| 1. PB | GO:0019899 | enzyme binding |
| 2. P | GO:1990429 | peroxisomal importomer complex |
| 2. P | GO:0043005 | neuron projection |
| 2. P | GO:0005874 | microtubule |
| 2. P | GO:0042391 | regulation of membrane potential |
| 2. P | GO:0072318 | clathrin coat disassembly |
| 2. P | GO:0007091 | metaphase/anaphase transition of mitotic cell cycle |
| 2. P | GO:0043227 | membrane-bounded organelle |
| 2. P | GO:0007005 | mitochondrion organization |
| 2. P | GO:0005871 | kinesin complex |
| 2. P | GO:0048309 | endoplasmic reticulum inheritance |
| 2. P | GO:0045765 | regulation of angiogenesis |
| 2. P | GO:0031514 | motile cilium |
| 2. P | GO:0035617 | stress granule disassembly |
| 2. P | GO:0035269 | protein O-linked mannosylation |
| 2. P | GO:0035418 | protein localization to synapse |
| 2. P | GO:1905553 | regulation of blood vessel branching |
| 2. P | GO:0019894 | kinesin binding |
| 2. P | GO:0042073 | intraciliary transport |
| 2. P | GO:0031207 | Sec62/Sec63 complex |
| 2. P | GO:0045842 | positive regulation of mitotic metaphase/anaphase transition |
| 2. P | GO:0032781 | positive regulation of ATP-dependent activity |
| 2. P | GO:0031982 | vesicle |
| 2. P | GO:0004169 | dolichyl-phosphate-mannose-protein mannosyltransferase activity |
| 2. P | GO:0008088 | axo-dendritic transport |
| 2. P | GO:0035253 | ciliary rootlet |
| 3. B | GO:0030850 | prostate gland development |
| 3. B | GO:0034450 | ubiquitin-ubiquitin ligase activity |
| 3. B | GO:0031398 | positive regulation of protein ubiquitination |
| 3. B | GO:0045862 | positive regulation of proteolysis |
| 3. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 3. B | GO:0051787 | misfolded protein binding |
| 3. B | GO:0048156 | tau protein binding |
| 3. B | GO:0006515 | protein quality control for misfolded or incompletely synthesized proteins |
| 3. B | GO:0015450 | protein-transporting ATPase activity |
| 3. B | GO:1901215 | negative regulation of neuron death |
| 3. B | GO:0046686 | response to cadmium ion |
| 3. B | GO:0032091 | negative regulation of protein binding |
| 3. B | GO:2000324 | positive regulation of glucocorticoid receptor signaling pathway |
| 3. B | GO:0051131 | chaperone-mediated protein complex assembly |
| 3. B | GO:0044877 | protein-containing complex binding |
| 3. B | GO:0097255 | R2TP complex |
| 3. B | GO:0010187 | negative regulation of seed germination |
| 3. B | GO:0007517 | muscle organ development |
| 3. B | GO:0007338 | single fertilization |
| 3. B | GO:0061084 | negative regulation of protein refolding |
| 3. B | GO:0004842 | ubiquitin-protein transferase activity |
| 3. B | GO:0120293 | dynein axonemal particle |
| 3. B | GO:0043278 | response to morphine |
| 3. B | GO:0000413 | protein peptidyl-prolyl isomerization |
| 3. B | GO:0030018 | Z disc |
| 3. B | GO:0006463 | steroid hormone receptor complex assembly |
| 3. B | GO:1900150 | regulation of defense response to fungus |
| 3. B | GO:0098850 | extrinsic component of synaptic vesicle membrane |
| 3. B | GO:0004722 | protein serine/threonine phosphatase activity |
| 3. B | GO:0042030 | ATPase inhibitor activity |
| 3. B | GO:0010017 | red or far-red light signaling pathway |
| 3. B | GO:0070534 | protein K63-linked ubiquitination |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0016020 | membrane |
| 3. B | GO:0106307 | |
| 3. B | GO:0098761 | cellular response to interleukin-7 |
| 3. B | GO:0038128 | ERBB2 signaling pathway |
| 3. B | GO:0071816 | tail-anchored membrane protein insertion into ER membrane |
| 3. B | GO:0016576 | histone dephosphorylation |
| 3. B | GO:0007346 | regulation of mitotic cell cycle |
| 3. B | GO:0065003 | protein-containing complex assembly |
| 3. B | GO:0030544 | Hsp70 protein binding |
| 3. B | GO:0010288 | response to lead ion |
| 3. B | GO:0071365 | cellular response to auxin stimulus |
| 3. B | GO:0071456 | cellular response to hypoxia |
| 3. B | GO:0090035 | positive regulation of chaperone-mediated protein complex assembly |
| 3. B | GO:0006470 | protein dephosphorylation |
| 3. B | GO:1904288 | BAT3 complex binding |
| 3. B | GO:0006970 | response to osmotic stress |
| 3. B | GO:0005856 | cytoskeleton |
| 3. B | GO:0001965 | G-protein alpha-subunit binding |
| 3. B | GO:0031371 | ubiquitin conjugating enzyme complex |
| 3. B | GO:0005741 | mitochondrial outer membrane |
| 3. B | GO:0071218 | cellular response to misfolded protein |
| 3. B | GO:0070262 | peptidyl-serine dephosphorylation |
| 3. B | GO:0051085 | chaperone cofactor-dependent protein refolding |
| 3. B | GO:1990635 | proximal dendrite |
| 3. B | GO:0009408 | response to heat |
| 3. B | GO:0048608 | reproductive structure development |
| 3. B | GO:0030433 | ubiquitin-dependent ERAD pathway |
| 3. B | GO:0051087 | chaperone binding |
| 3. B | GO:0061684 | chaperone-mediated autophagy |
| 3. B | GO:0030579 | ubiquitin-dependent SMAD protein catabolic process |
| 3. B | GO:0060548 | negative regulation of cell death |
| 3. B | GO:0000151 | ubiquitin ligase complex |
| 3. B | GO:0016791 | phosphatase activity |
| 3. B | GO:0050821 | protein stabilization |
| 3. B | GO:1903071 | positive regulation of ER-associated ubiquitin-dependent protein catabolic process |
| 3. B | GO:0010286 | heat acclimation |
| 3. B | GO:0070286 | axonemal dynein complex assembly |
| 3. B | GO:0032564 | dATP binding |
| 3. B | GO:0002931 | response to ischemia |
| 3. B | GO:0006626 | protein targeting to mitochondrion |
| 3. B | GO:1990225 | rhoptry neck |
| 3. B | GO:0051865 | protein autoubiquitination |
| 3. B | GO:0070301 | cellular response to hydrogen peroxide |
| 3. B | GO:0046661 | male sex differentiation |
| 3. B | GO:0000209 | protein polyubiquitination |
| 3. B | GO:0071276 | cellular response to cadmium ion |
| 3. B | GO:0032767 | copper-dependent protein binding |
| 3. B | GO:0043621 | protein self-association |
| 3. B | GO:0045920 | negative regulation of exocytosis |
| 3. B | GO:2000059 | negative regulation of ubiquitin-dependent protein catabolic process |
| 3. B | GO:1903070 | negative regulation of ER-associated ubiquitin-dependent protein catabolic process |
| 3. B | GO:0043947 | obsolete positive regulation by host of symbiont catalytic activity |
| 3. B | GO:0005634 | nucleus |
| 3. B | GO:1902325 | negative regulation of chlorophyll biosynthetic process |
| 3. B | GO:0031647 | regulation of protein stability |
| 3. B | GO:0004721 | phosphoprotein phosphatase activity |
| 3. B | GO:0043204 | perikaryon |
| 3. B | GO:0051879 | Hsp90 protein binding |
| 3. B | GO:0046983 | protein dimerization activity |
| 3. B | GO:0010771 | negative regulation of cell morphogenesis involved in differentiation |
| 3. B | GO:0048471 | perinuclear region of cytoplasm |
| 3. B | GO:0003755 | peptidyl-prolyl cis-trans isomerase activity |
| 3. B | GO:0050832 | defense response to fungus |
| 3. B | GO:0043531 | ADP binding |
| 3. B | GO:0060090 | molecular adaptor activity |
| 3. B | GO:0031111 | negative regulation of microtubule polymerization or depolymerization |
| 3. B | GO:1904550 | response to arachidonic acid |
| 3. B | GO:0046906 | tetrapyrrole binding |
| 3. B | GO:0045665 | negative regulation of neuron differentiation |
| 3. B | GO:0070936 | protein K48-linked ubiquitination |
| 3. B | GO:0042405 | nuclear inclusion body |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0046332 | SMAD binding |
| 3. B | GO:0044647 | host-symbiont bicellular tight junction |
| 3. B | GO:0031503 | protein-containing complex localization |
| 3. B | GO:0031943 | regulation of glucocorticoid metabolic process |
| 3. B | GO:0019900 | kinase binding |
| 3. B | GO:0030968 | endoplasmic reticulum unfolded protein response |
| 3. B | GO:0001664 | G protein-coupled receptor binding |
| 3. B | GO:0030911 | TPR domain binding |
| 3. B | GO:0016607 | nuclear speck |
| 3. B | GO:0001933 | negative regulation of protein phosphorylation |
| 3. B | GO:0010019 | chloroplast-nucleus signaling pathway |
| 3. B | GO:0034605 | cellular response to heat |
| 3. B | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway |
| 3. B | GO:0070678 | preprotein binding |
| 3. B | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 3. B | GO:1900034 | regulation of cellular response to heat |
| 3. B | GO:0106306 | |
| 3. B | GO:0051443 | positive regulation of ubiquitin-protein transferase activity |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0032474 | otolith morphogenesis |
| 3. B | GO:0101031 | chaperone complex |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | O09012 | Peroxisomal targeting signal 1 receptor | 6.44e-03 | 2.92e-05 | 1.44e-04 |
| 1. PB | Q925N3 | PEX5-related protein | 1.15e-02 | 5.05e-08 | 0.013 |
| 1. PB | Q3ZBR5 | Tetratricopeptide repeat protein 1 | 4.16e-05 | 1.63e-04 | 0.030 |
| 1. PB | Q49AM3 | Tetratricopeptide repeat protein 31 | 0 | 5.08e-146 | 0.0 |
| 1. PB | O70525 | Peroxisomal targeting signal 1 receptor | 7.91e-03 | 1.91e-05 | 1.03e-04 |
| 1. PB | Q2M2R8 | Peroxisomal targeting signal 1 receptor | 1.32e-02 | 8.09e-05 | 8.73e-05 |
| 1. PB | Q5ZMQ9 | Peroxisomal targeting signal 1 receptor | 3.37e-02 | 4.02e-04 | 2.34e-04 |
| 1. PB | Q1RMV0 | Peroxisomal targeting signal 1 receptor | 7.61e-02 | 2.11e-05 | 1.13e-04 |
| 1. PB | Q920N5 | Peroxisomal targeting signal 1 receptor | 1.24e-02 | 1.20e-04 | 8.58e-05 |
| 1. PB | Q8C437 | PEX5-related protein | 5.70e-03 | 6.41e-07 | 0.018 |
| 1. PB | P50542 | Peroxisomal targeting signal 1 receptor | 1.62e-02 | 3.50e-05 | 1.05e-04 |
| 1. PB | Q84JR9 | TPR repeat-containing thioredoxin TTL4 | 2.31e-02 | 1.22e-02 | 7.40e-04 |
| 1. PB | Q91Z38 | Tetratricopeptide repeat protein 1 | 1.07e-04 | 1.07e-03 | 0.025 |
| 1. PB | Q8IYB4 | PEX5-related protein | 1.12e-02 | 1.87e-07 | 0.010 |
| 2. P | Q2HCV7 | ATP-dependent RNA helicase ROK1 | 4.95e-01 | 1.97e-02 | NA |
| 2. P | P35056 | Peroxisomal targeting signal receptor | 8.68e-03 | 4.87e-05 | NA |
| 2. P | O14085 | Translocation protein sec72 | 5.65e-05 | 1.28e-03 | NA |
| 2. P | O35450 | FK506-binding protein-like | 5.17e-04 | 1.22e-02 | NA |
| 2. P | Q91W40 | Kinesin light chain 3 | 3.44e-02 | 5.20e-03 | NA |
| 2. P | Q04364 | Peroxisomal targeting signal receptor 9 | 1.84e-02 | 1.39e-02 | NA |
| 2. P | Q99614 | Tetratricopeptide repeat protein 1 | 1.97e-05 | 8.85e-05 | NA |
| 2. P | Q9XT11 | Peptidyl-prolyl cis-trans isomerase FKBP5 | 3.11e-02 | 1.17e-02 | NA |
| 2. P | Q54MD1 | Peroxisomal targeting signal 1 receptor | 6.71e-02 | 2.04e-03 | NA |
| 2. P | Q86B11 | Anaphase-promoting complex subunit 8 | 1.72e-02 | 2.08e-02 | NA |
| 2. P | Q7K4B6 | Protein O-mannosyl-transferase Tmtc3 | 3.21e-02 | 3.52e-02 | NA |
| 2. P | O94325 | Peroxisomal targeting signal receptor | 5.07e-02 | 2.91e-04 | NA |
| 2. P | Q5F3K0 | Tetratricopeptide repeat protein 27 | 3.51e-02 | 4.63e-02 | NA |
| 2. P | Q9XSH5 | Peptidyl-prolyl cis-trans isomerase FKBP5 | 1.99e-02 | 1.35e-02 | NA |
| 2. P | Q6FM42 | Peroxisomal targeting signal receptor | 9.20e-02 | 1.14e-03 | NA |
| 2. P | Q54VG4 | Small glutamine-rich tetratricopeptide repeat-containing protein | 4.16e-05 | 3.23e-03 | NA |
| 2. P | Q99144 | Peroxisomal targeting signal receptor | 5.45e-02 | 2.48e-02 | NA |
| 2. P | Q68G30 | Kinesin light chain 3 | 2.04e-03 | 1.03e-02 | NA |
| 2. P | O88447 | Kinesin light chain 1 | 2.32e-03 | 2.89e-02 | NA |
| 2. P | O36033 | TPR repeat-containing protein C19B12.01 | 1.81e-02 | 4.55e-02 | NA |
| 2. P | Q06677 | Auxilin-like clathrin uncoating factor SWA2 | 7.52e-03 | 1.49e-03 | NA |
| 2. P | Q5R8E2 | Kinesin light chain 3 | 2.96e-03 | 2.70e-02 | NA |
| 3. B | Q496Y0 | LON peptidase N-terminal domain and RING finger protein 3 | 2.90e-02 | NA | 5.81e-05 |
| 3. B | Q99KD5 | Protein unc-45 homolog A | 7.68e-03 | NA | 0.001 |
| 3. B | Q9Y2Z0 | Protein SGT1 homolog | 2.99e-03 | NA | 0.017 |
| 3. B | Q84K11 | Serine/threonine-protein phosphatase 5 | 5.53e-07 | NA | 4.63e-11 |
| 3. B | Q43468 | Hsp70-Hsp90 organizing protein 1 | 3.27e-03 | NA | 1.34e-12 |
| 3. B | D3ZSP7 | E3 ubiquitin-protein ligase TTC3 | 2.03e-01 | NA | 1.29e-09 |
| 3. B | Q8IDX6 | Reticulocyte-binding protein homolog 2a | NA | NA | 0.031 |
| 3. B | Q04737 | TPR repeat-containing protein slr0751 | 4.38e-05 | NA | 8.60e-06 |
| 3. B | Q15785 | Mitochondrial import receptor subunit TOM34 | 9.48e-05 | NA | 0.011 |
| 3. B | P53804 | E3 ubiquitin-protein ligase TTC3 | 4.36e-01 | NA | 2.59e-07 |
| 3. B | Q7ZWU1 | Stress-induced-phosphoprotein 1 | 8.30e-04 | NA | 9.61e-10 |
| 3. B | A4K2V0 | Mitochondrial import receptor subunit TOM34 | 9.51e-05 | NA | 0.012 |
| 3. B | P0CT30 | Small glutamine-rich tetratricopeptide repeat-containing protein 2 | 4.85e-05 | NA | 2.59e-05 |
| 3. B | Q9H3U1 | Protein unc-45 homolog A | 1.23e-03 | NA | 0.018 |
| 3. B | Q9STH1 | Hsp70-Hsp90 organizing protein 3 | 1.69e-03 | NA | 3.55e-12 |
| 3. B | Q54DA8 | Protein STIP1 homolog | 1.94e-03 | NA | 1.04e-09 |
| 3. B | Q5R8D8 | DnaJ homolog subfamily C member 7 | 1.76e-04 | NA | 1.87e-04 |
| 3. B | Q5ZLF0 | Hsc70-interacting protein | 8.37e-04 | NA | 0.018 |
| 3. B | P53043 | Serine/threonine-protein phosphatase T | 6.06e-07 | NA | 0.002 |
| 3. B | Q8BJU0 | Small glutamine-rich tetratricopeptide repeat-containing protein alpha | 1.10e-06 | NA | 1.07e-07 |
| 3. B | O70593 | Small glutamine-rich tetratricopeptide repeat-containing protein alpha | 3.00e-05 | NA | 1.17e-07 |
| 3. B | Q96EQ0 | Small glutamine-rich tetratricopeptide repeat-containing protein beta | 1.09e-04 | NA | 2.51e-07 |
| 3. B | F4IXE4 | TPR repeat-containing thioredoxin TTL2 | 6.19e-03 | NA | 3.42e-04 |
| 3. B | Q95LZ5 | Tetratricopeptide repeat protein 16 | 3.87e-02 | NA | 0.014 |
| 3. B | Q8IZP2 | Putative protein FAM10A4 | 2.03e-03 | NA | 0.002 |
| 3. B | P07213 | Mitochondrial import receptor subunit TOM70 | 2.65e-03 | NA | 0.020 |
| 3. B | Q6ES52 | TPR repeat-containing thioredoxin TDX | 4.05e-04 | NA | 0.024 |
| 3. B | Q28IV3 | RNA polymerase II-associated protein 3 | 2.23e-02 | NA | 0.002 |
| 3. B | Q96AY4 | Tetratricopeptide repeat protein 28 | 3.60e-01 | NA | 4.67e-10 |
| 3. B | Q5U2X2 | Sperm-associated antigen 1 | 1.94e-02 | NA | 7.23e-05 |
| 3. B | Q93YR3 | FAM10 family protein At4g22670 | 3.92e-03 | NA | 2.33e-05 |
| 3. B | Q32NU8 | Outer dynein arm-docking complex subunit 4 | 6.29e-04 | NA | 3.27e-04 |
| 3. B | Q32PZ3 | Protein unc-45 homolog A | 1.36e-03 | NA | 5.72e-04 |
| 3. B | P31948 | Stress-induced-phosphoprotein 1 | 1.98e-03 | NA | 3.36e-09 |
| 3. B | P53042 | Serine/threonine-protein phosphatase 5 | 5.91e-06 | NA | 1.02e-08 |
| 3. B | Q80XJ3 | Tetratricopeptide repeat protein 28 | 4.96e-01 | NA | 1.24e-09 |
| 3. B | Q12118 | Small glutamine-rich tetratricopeptide repeat-containing protein 2 | 6.97e-06 | NA | 2.13e-05 |
| 3. B | Q5WA76 | U-box domain-containing protein 70 | 1.51e-03 | NA | 3.42e-08 |
| 3. B | Q99615 | DnaJ homolog subfamily C member 7 | 2.45e-04 | NA | 2.35e-04 |
| 3. B | P15705 | Heat shock protein STI1 | 2.29e-03 | NA | 1.60e-09 |
| 3. B | Q9USI5 | Heat shock protein sti1 homolog | 1.15e-03 | NA | 4.07e-09 |
| 3. B | Q07617 | Sperm-associated antigen 1 | 5.00e-04 | NA | 0.004 |
| 3. B | Q2KIK0 | Protein SGT1 homolog | 1.62e-03 | NA | 0.028 |
| 3. B | Q9NES8 | Serine/threonine-protein phosphatase 5 | 5.48e-07 | NA | 4.00e-04 |
| 3. B | Q9LNB6 | Hsp70-Hsp90 organizing protein 1 | 9.85e-04 | NA | 6.28e-13 |
| 3. B | Q6DI40 | Tetratricopeptide repeat protein 33 | 2.02e-04 | NA | 0.013 |
| 3. B | Q8NFI4 | Putative protein FAM10A5 | 9.03e-04 | NA | 0.021 |
| 3. B | Q9CX34 | Protein SGT1 homolog | 2.34e-04 | NA | 0.037 |
| 3. B | O13797 | Small glutamine-rich tetratricopeptide repeat-containing protein 2 | 2.45e-03 | NA | 1.01e-04 |
| 3. B | Q84XU2 | Serine/threonine-protein phosphatase 5 | 1.36e-07 | NA | 2.93e-10 |
| 3. B | O35814 | Stress-induced-phosphoprotein 1 | 1.22e-03 | NA | 7.93e-10 |
| 3. B | P50503 | Hsc70-interacting protein | 1.34e-03 | NA | 0.019 |
| 3. B | Q80W98 | Small glutamine-rich tetratricopeptide repeat-containing protein beta | 2.09e-07 | NA | 1.79e-06 |
| 3. B | O54981 | Stress-induced-phosphoprotein 1 | 8.38e-04 | NA | 7.46e-10 |
| 3. B | Q9HGM9 | DnaJ homolog subfamily C member 7 homolog | 5.96e-03 | NA | 6.20e-04 |
| 3. B | Q9MAH1 | TPR repeat-containing thioredoxin TTL1 | 4.64e-02 | NA | 0.021 |
| 3. B | Q9XSI2 | Peptidyl-prolyl cis-trans isomerase FKBP5 | 3.13e-02 | NA | 0.021 |
| 3. B | Q60676 | Serine/threonine-protein phosphatase 5 | 6.86e-06 | NA | 6.34e-08 |
| 3. B | F1RBN2 | Sperm-associated antigen 1A | 5.70e-04 | NA | 0.022 |
| 3. B | O16259 | Stress-induced-phosphoprotein 1 | 6.32e-05 | NA | 1.25e-05 |
| 3. B | Q9UNE7 | E3 ubiquitin-protein ligase CHIP | 3.81e-04 | NA | 0.001 |
| 3. B | Q6PID6 | Tetratricopeptide repeat protein 33 | 2.53e-05 | NA | 0.030 |
| 3. B | O43049 | Serine/threonine-protein phosphatase T | 1.54e-07 | NA | 1.35e-06 |
| 3. B | Q9D706 | RNA polymerase II-associated protein 3 | 1.39e-02 | NA | 1.26e-04 |
| 3. B | Q60864 | Stress-induced-phosphoprotein 1 | 5.50e-04 | NA | 7.59e-10 |
| 3. B | Q4R8N7 | Stress-induced-phosphoprotein 1 | 1.16e-03 | NA | 1.06e-09 |
| 3. B | Q68FQ7 | RNA polymerase II-associated protein 3 | 2.07e-02 | NA | 5.05e-04 |
| 3. B | Q9H6T3 | RNA polymerase II-associated protein 3 | 6.60e-02 | NA | 2.17e-04 |
| 3. B | P53041 | Serine/threonine-protein phosphatase 5 | 1.55e-07 | NA | 9.33e-09 |
| 3. B | Q8VWG7 | TPR repeat-containing thioredoxin TDX | 1.14e-03 | NA | 0.003 |
| 3. B | A6ZRW3 | Mitochondrial import receptor subunit TOM70 | 8.92e-03 | NA | 0.020 |
| 3. B | P25407 | STI1-like protein (Fragment) | 1.13e-07 | NA | 4.18e-10 |
| 3. B | O88196 | E3 ubiquitin-protein ligase TTC3 | 3.17e-01 | NA | 2.05e-09 |
| 3. B | Q9D4H7 | LON peptidase N-terminal domain and RING finger protein 3 | 7.18e-02 | NA | 7.78e-05 |
| 3. B | Q5XEP2 | Hsp70-Hsp90 organizing protein 2 | 9.64e-04 | NA | 3.13e-12 |
| 3. B | Q5RF88 | Peptidyl-prolyl cis-trans isomerase FKBP5 | 1.16e-01 | NA | 0.026 |
| 3. B | P50502 | Hsc70-interacting protein | 5.21e-04 | NA | 0.040 |
| 3. B | Q8NEE8 | Tetratricopeptide repeat protein 16 | 1.22e-02 | NA | 0.009 |
| 3. B | P23231 | Mitochondrial import receptor subunit tom70 | 3.98e-03 | NA | 7.55e-04 |
| 3. B | Q0JL44 | Protein SGT1 homolog | 1.33e-05 | NA | 3.92e-05 |
| 3. B | B0BN85 | Protein SGT1 homolog | 3.57e-03 | NA | 0.013 |
| 3. B | P30416 | Peptidyl-prolyl cis-trans isomerase FKBP4 | 1.81e-02 | NA | 0.023 |
| 3. B | Q8HXH0 | LON peptidase N-terminal domain and RING finger protein 3 | 4.57e-02 | NA | 0.026 |
| 3. B | Q9SUT5 | Protein SGT1 homolog B | 9.62e-06 | NA | 0.001 |
| 3. B | Q6NU95 | RNA polymerase II-associated protein 3 | 5.14e-02 | NA | 0.001 |
| 3. B | Q9QYI3 | DnaJ homolog subfamily C member 7 | 1.08e-03 | NA | 3.53e-04 |
| 3. B | Q99L47 | Hsc70-interacting protein | 8.74e-04 | NA | 0.040 |
| 3. B | Q80ZX8 | Sperm-associated antigen 1 | 5.08e-03 | NA | 5.10e-05 |
| 3. B | Q7ZU45 | Outer dynein arm-docking complex subunit 4 | 7.39e-04 | NA | 2.09e-05 |
| 3. B | P38042 | Anaphase-promoting complex subunit CDC27 | 5.72e-02 | NA | 0.012 |
| 3. B | Q5RF31 | Hsc70-interacting protein | 3.22e-03 | NA | 0.032 |
| 3. B | Q9WUD1 | E3 ubiquitin-protein ligase CHIP | 2.05e-05 | NA | 8.82e-05 |
| 3. B | O43765 | Small glutamine-rich tetratricopeptide repeat-containing protein alpha | 6.09e-06 | NA | 4.08e-07 |
| 3. B | Q13451 | Peptidyl-prolyl cis-trans isomerase FKBP5 | 8.95e-02 | NA | 0.043 |
| 3. B | F8RP11 | Hsp70-Hsp90 organizing protein | 2.07e-03 | NA | 3.15e-07 |
| 3. B | Q32LM2 | Small glutamine-rich tetratricopeptide repeat-containing protein alpha | 4.44e-03 | NA | 3.44e-07 |
| 3. B | Q5ZHY5 | E3 ubiquitin-protein ligase CHIP | 6.85e-04 | NA | 0.003 |
| 3. B | Q9SUR9 | Protein SGT1 homolog A | 3.57e-07 | NA | 0.001 |
| 3. B | Q944A7 | Serine/threonine-protein kinase BSK1 | 5.10e-02 | NA | 0.047 |
| 3. B | Q8ILC1 | STI1-like protein | 7.64e-03 | NA | 3.55e-09 |
| 3. B | Q3ZBZ8 | Stress-induced-phosphoprotein 1 | 1.13e-03 | NA | 6.05e-10 |
| 3. B | Q8VD33 | Small glutamine-rich tetratricopeptide repeat-containing protein beta | 2.01e-04 | NA | 1.79e-06 |