Summary

Q4KMX7

Homolog: P0CH98.
Function: Protein FAM106C.

Statistics

Total GO Annotation: 7
Unique PROST Go: 7
Unique BLAST Go: 0

Total Homologs: 8
Unique PROST Homologs: 6
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P0CH98 (Protein FAM106C) with a FATCAT P-Value: 0.00995 and RMSD of 4.39 angstrom. The sequence alignment identity is 98.8%.
Structural alignment shown in left. Query protein Q4KMX7 colored as red in alignment, homolog P0CH98 colored as blue. Query protein Q4KMX7 is also shown in right top, homolog P0CH98 showed in right bottom. They are colored based on secondary structures. 

  Q4KMX7 MLPSTMFLVHLPLSTNRLHCLRNTSLESYLCSFVHLNHPLHISDRVILISLHEAVRFSFAFSFPRGTLSIAYCLMSSVSTSSEAIMSTELLANYCHSSLH 100
  P0CH98 MLPSTMFLVHLPLSTNRLHCLRNTSLESCLCSFVHLNHPLHISDPVILISLHEAVRFSFAFSFPRGTLSIAYCLMSSVSTSSEAIMSTELLANYCHSSLH 100

  Q4KMX7 VCICISSFPNETGNHDSFPGAVVSISDQPTDQCKLAAKELPLRNLLECRFFDCMGEEDLINLGVIGTER 169
  P0CH98 VCICISSFPNETGNHDSFPGAVVSISDQPTDQCKLAAKELPLRNLLECRFFDCMGEEDLINLGVIGTER 169

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0030833 regulation of actin filament polymerization
2. P GO:0051650 establishment of vesicle localization
2. P GO:0016324 apical plasma membrane
2. P GO:0010215 cellulose microfibril organization
2. P GO:0017157 regulation of exocytosis
2. P GO:0040008 regulation of growth
2. P GO:0009860 pollen tube growth

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q4KMX7 Protein FAM106A 0 1.89e-148 1.61e-121
1. PB P0CH98 Protein FAM106C 9.95e-03 1.82e-46 3.26e-118
2. P A1L4Q6 Putative uncharacterized protein FLJ41423 3.02e-01 4.67e-02 NA
2. P A6NEH8 Putative uncharacterized protein encoded by ZNF503-AS2 4.35e-01 1.64e-02 NA
2. P P53071 Uncharacterized protein YGL235W 6.97e-01 2.96e-05 NA
2. P Q9FFD5 CRIB domain-containing protein RIC4 4.43e-01 3.05e-02 NA
2. P P03124 Probable protein E4 NA 3.00e-02 NA
2. P P14723 Uncharacterized 16 kDa protein in middle repetitive insertion sequence WIS1 4.00e-01 1.26e-03 NA