Summary

Q4V326

Homolog: P0CL80.
Function: G antigen 12F.

Statistics

Total GO Annotation: 0
Unique PROST Go: 0
Unique BLAST Go: 0

Total Homologs: 21
Unique PROST Homologs: 0
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P0CL80 (G antigen 12F) with a FATCAT P-Value: 1.67e-11 and RMSD of 1.93 angstrom. The sequence alignment identity is 94.0%.
Structural alignment shown in left. Query protein Q4V326 colored as red in alignment, homolog P0CL80 colored as blue. Query protein Q4V326 is also shown in right top, homolog P0CL80 showed in right bottom. They are colored based on secondary structures. 

  Q4V326 MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPP 100
  P0CL80 MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPP 100

  Q4V326 NPEEVKTPEE------- 110
  P0CL80 NPEEVKTPEEGEKQSQC 117

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8WWM1 X antigen family member 5 4.16e-03 1.90e-03 1.11e-05
1. PB A6NGK3 G antigen 10 4.94e-07 6.24e-36 1.76e-59
1. PB A6NDE8 G antigen 12H 4.80e-08 1.32e-56 3.95e-72
1. PB P0CL82 G antigen 12I 5.03e-08 1.89e-63 8.85e-74
1. PB Q13069 G antigen 5 4.49e-08 4.40e-60 7.88e-72
1. PB Q4V326 G antigen 2E 0 8.86e-138 9.80e-74
1. PB Q8WTP9 X antigen family member 3 5.32e-03 2.76e-07 3.12e-11
1. PB Q13070 G antigen 6 6.17e-09 1.48e-55 2.69e-71
1. PB P0CL80 G antigen 12F 1.67e-11 1.89e-63 8.85e-74
1. PB O76087 G antigen 7 1.69e-08 1.89e-63 8.85e-74
1. PB A6NER3 G antigen 12J 1.47e-08 3.33e-46 4.51e-71
1. PB P0DSO3 G antigen 4 1.53e-07 4.55e-61 1.93e-72
1. PB Q6NT46 G antigen 2A 1.02e-08 3.31e-44 2.04e-68
1. PB P0DTW1 G antigen 1 1.63e-07 7.54e-68 2.52e-72
1. PB Q4V321 G antigen 13 1.35e-07 5.37e-58 7.14e-72
1. PB P0CL81 G antigen 12G 4.36e-08 1.89e-63 8.85e-74
1. PB Q9UEU5 G antigen 2D 5.17e-07 1.25e-46 1.42e-67
1. PB A1L429 G antigen 12B/C/D/E 5.33e-09 8.71e-58 1.42e-72
1. PB Q13066 G antigen 2B/2C 3.78e-07 3.98e-46 7.51e-69
3. B Q96GT9 X antigen family member 2 4.01e-03 NA 7.32e-15
3. B O75459 P antigen family member 1 2.46e-03 NA 2.40e-13