Summary

Q53H64

Homolog: Q9VJ33.
Function: NEDD8.

Statistics

Total GO Annotation: 57
Unique PROST Go: 57
Unique BLAST Go: 0

Total Homologs: 272
Unique PROST Homologs: 269
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q9VJ33 (NEDD8) with a FATCAT P-Value: 1.91e-07 and RMSD of 2.04 angstrom. The sequence alignment identity is 16.4%.
Structural alignment shown in left. Query protein Q53H64 colored as red in alignment, homolog Q9VJ33 colored as blue. Query protein Q53H64 is also shown in right top, homolog Q9VJ33 showed in right bottom. They are colored based on secondary structures. 

  Q53H64 MAEPEQDIGEKPAVRIQNPKENDFIEIELKRQELSYQNLLNVSCCELGIKP-ERVEKIR-----K--LP---NTLLRKDK---DIRRLRDFQ-----EVE 81
  Q9VJ33 -----------------------ML-IKVKT--LTGKEI------EIDIEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQMNDDKTAADYKVQGGSVLH 68

  Q53H64 LIL-MKNGSSRLTEYVPSLTERPCYDSKAAKMTY 114
  Q9VJ33 LVLALRGGDSILT---------PCV--------- 84

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0050905 neuromuscular process
2. P GO:0030162 regulation of proteolysis
2. P GO:0006613 cotranslational protein targeting to membrane
2. P GO:0071569 protein ufmylation
2. P GO:1900180 regulation of protein localization to nucleus
2. P GO:0007420 brain development
2. P GO:0044389 ubiquitin-like protein ligase binding
2. P GO:0048500 signal recognition particle
2. P GO:0044754 autolysosome
2. P GO:0000422 autophagy of mitochondrion
2. P GO:0019789 SUMO transferase activity
2. P GO:0070257 positive regulation of mucus secretion
2. P GO:0005762 mitochondrial large ribosomal subunit
2. P GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
2. P GO:0042308 negative regulation of protein import into nucleus
2. P GO:0033146 regulation of intracellular estrogen receptor signaling pathway
2. P GO:0006501 C-terminal protein lipidation
2. P GO:0042203 toluene catabolic process
2. P GO:0045116 protein neddylation
2. P GO:0031625 ubiquitin protein ligase binding
2. P GO:0005786 signal recognition particle, endoplasmic reticulum targeting
2. P GO:0009507 chloroplast
2. P GO:0008312 7S RNA binding
2. P GO:0003735 structural constituent of ribosome
2. P GO:0000421 autophagosome membrane
2. P GO:0016605 PML body
2. P GO:0031386 protein tag
2. P GO:0005840 ribosome
2. P GO:0043392 negative regulation of DNA binding
2. P GO:2000736 regulation of stem cell differentiation
2. P GO:0001650 fibrillar center
2. P GO:0034976 response to endoplasmic reticulum stress
2. P GO:0018645 alkene monooxygenase activity
2. P GO:0009536 plastid
2. P GO:0036099 female germ-line stem cell population maintenance
2. P GO:0030163 protein catabolic process
2. P GO:0006614 SRP-dependent cotranslational protein targeting to membrane
2. P GO:0051438 regulation of ubiquitin-protein transferase activity
2. P GO:0061709 reticulophagy
2. P GO:1990592 protein K69-linked ufmylation
2. P GO:0008104 protein localization
2. P GO:0019941 modification-dependent protein catabolic process
2. P GO:0005634 nucleus
2. P GO:0032543 mitochondrial translation
2. P GO:0034274 Atg12-Atg5-Atg16 complex
2. P GO:0016925 protein sumoylation
2. P GO:0044804 autophagy of nucleus
2. P GO:0006508 proteolysis
2. P GO:0000027 ribosomal large subunit assembly
2. P GO:2000060 positive regulation of ubiquitin-dependent protein catabolic process
2. P GO:0000045 autophagosome assembly
2. P GO:0022625 cytosolic large ribosomal subunit
2. P GO:0014070 response to organic cyclic compound
2. P GO:0006412 translation
2. P GO:0034504 protein localization to nucleus
2. P GO:0019843 rRNA binding
2. P GO:0006617 SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q53H64 Putative ANKRD40 C-terminal-like protein 0 1.99e-121 3.75e-79
2. P Q15843 NEDD8 3.40e-07 2.43e-04 NA
2. P B8D7F0 Protein RnfH 8.66e-04 1.95e-02 NA
2. P Q9ZET6 Alkene monooxygenase system, oxygenase component subunit gamma 9.98e-04 3.01e-04 NA
2. P B4S5M5 50S ribosomal protein L23 6.95e-02 2.62e-03 NA
2. P Q17QV3 Small ubiquitin-related modifier 3 1.38e-06 3.02e-03 NA
2. P B5LVL2 Ubiquitin-fold modifier 1 1.81e-05 7.06e-06 NA
2. P A9VP79 50S ribosomal protein L23 4.14e-02 4.57e-02 NA
2. P B0RZU2 50S ribosomal protein L23 4.57e-02 8.25e-03 NA
2. P Q54TK0 NEDD8-like protein 1 2.01e-06 9.66e-04 NA
2. P P69667 50S ribosomal protein L23, chloroplastic 7.42e-02 4.93e-04 NA
2. P Q9MDA1 50S ribosomal protein L23, chloroplastic 5.82e-02 6.36e-03 NA
2. P Q2PMM4 50S ribosomal protein L23, chloroplastic 5.26e-02 2.65e-03 NA
2. P B5E0K3 Ubiquitin-fold modifier 1 2.42e-05 3.45e-02 NA
2. P P35544 Ubiquitin-like protein FUBI 2.81e-06 1.31e-02 NA
2. P Q2WGC1 50S ribosomal protein L23, chloroplastic 2.08e-01 1.40e-03 NA
2. P C0M6X1 50S ribosomal protein L23 7.03e-02 1.78e-02 NA
2. P Q2KJG2 Ubiquitin-fold modifier 1 1.87e-05 2.26e-05 NA
2. P Q8LW11 50S ribosomal protein L23, chloroplastic 5.26e-02 7.33e-04 NA
2. P Q0SN27 50S ribosomal protein L23 5.30e-02 3.39e-03 NA
2. P Q09FP7 50S ribosomal protein L23, chloroplastic 6.19e-02 5.67e-04 NA
2. P A1W1V8 50S ribosomal protein L23 7.48e-02 7.86e-04 NA
2. P Q05474 Ubiquitin-like protein FUBI 2.27e-06 2.97e-03 NA
2. P Q5XK67 DNA-directed RNA polymerases I and III subunit RPAC2 1.64e-01 4.22e-02 NA
2. P P09132 Signal recognition particle 19 kDa protein 4.52e-01 4.53e-02 NA
2. P P0C450 50S ribosomal protein L23, chloroplastic 7.36e-02 4.93e-04 NA
2. P Q7FNR4 50S ribosomal protein L23, chloroplastic 6.06e-02 1.41e-03 NA
2. P Q02W26 50S ribosomal protein L23 4.66e-02 1.54e-02 NA
2. P Q6ENR9 50S ribosomal protein L23, chloroplastic 7.43e-02 3.95e-04 NA
2. P Q9SW27 Membrane-anchored ubiquitin-fold protein 3 2.73e-02 4.65e-07 NA
2. P A1BJ32 50S ribosomal protein L23 9.03e-02 2.95e-04 NA
2. P Q6APV7 ATP-dependent Clp protease adapter protein ClpS 2.58e-01 2.89e-02 NA
2. P Q6IQS9 39S ribosomal protein L23, mitochondrial 7.30e-02 2.13e-04 NA
2. P Q2VED8 50S ribosomal protein L23, chloroplastic 6.07e-02 1.41e-03 NA
2. P Q6ENC8 50S ribosomal protein L23, chloroplastic 7.44e-02 4.93e-04 NA
2. P Q09WV6 50S ribosomal protein L23, chloroplastic 5.59e-02 1.10e-02 NA
2. P P09387 50S ribosomal protein L23, chloroplastic 7.67e-02 3.95e-04 NA
2. P B6YW35 30S ribosomal protein S24e 2.52e-02 3.63e-02 NA
2. P Q7VGE2 50S ribosomal protein L23 8.09e-02 3.20e-04 NA
2. P A3DER9 ATP-dependent Clp protease adapter protein ClpS 1.67e-01 2.11e-02 NA
2. P Q0G9F6 50S ribosomal protein L23, chloroplastic 6.10e-02 1.86e-03 NA
2. P Q06GT3 50S ribosomal protein L23, chloroplastic 6.10e-02 8.49e-03 NA
2. P P61282 NEDD8 3.06e-07 2.43e-04 NA
2. P B7J245 50S ribosomal protein L23 6.10e-02 3.39e-03 NA
2. P A8YXK7 50S ribosomal protein L23 5.28e-02 2.80e-04 NA
2. P A4FZ58 30S ribosomal protein S24e 1.01e-02 1.83e-02 NA
2. P A5USI7 50S ribosomal protein L23 5.14e-02 1.89e-02 NA
2. P Q49KT5 50S ribosomal protein L23, chloroplastic 4.97e-02 6.15e-05 NA
2. P A5N4P9 50S ribosomal protein L23 5.54e-02 7.39e-03 NA
2. P Q3APH5 50S ribosomal protein L23 8.64e-02 8.34e-04 NA
2. P A5DWI6 Autophagy-related protein 8 4.77e-03 1.72e-04 NA
2. P Q93725 NEDD8 4.68e-07 2.33e-02 NA
2. P Q5TUE9 Probable 39S ribosomal protein L23, mitochondrial 9.35e-02 1.07e-03 NA
2. P Q61E22 Ubiquitin-fold modifier 1 1.05e-05 7.70e-04 NA
2. P O61749 Probable signal recognition particle 19 kDa protein 4.32e-01 1.25e-02 NA
2. P Q4N927 Ubiquitin-fold modifier 1 1.84e-05 1.11e-07 NA
2. P Q5FM88 50S ribosomal protein L23 5.90e-02 3.99e-04 NA
2. P P0C449 50S ribosomal protein L23, chloroplastic 5.68e-02 4.93e-04 NA
2. P Q33BY9 50S ribosomal protein L23, chloroplastic 6.46e-02 1.41e-03 NA
2. P A8DYH2 Ubiquitin-fold modifier 1 1.83e-05 3.03e-06 NA
2. P Q0PUX0 50S ribosomal protein L23, chloroplastic 5.87e-02 8.17e-04 NA
2. P B9ENM6 Ubiquitin-fold modifier 1 8.58e-04 7.64e-14 NA
2. P Q54L35 NEDD8-like protein 2 1.22e-06 1.06e-02 NA
2. P A5VLK3 50S ribosomal protein L23 6.16e-02 1.57e-03 NA
2. P A0RM13 50S ribosomal protein L23 7.23e-02 1.83e-04 NA
2. P Q5ZMK7 Ubiquitin-fold modifier 1 1.97e-05 5.47e-06 NA
2. P Q46G97 50S ribosomal protein L23 6.20e-02 1.33e-03 NA
2. P Q0PUX7 50S ribosomal protein L23, chloroplastic 6.30e-02 2.12e-03 NA
2. P Q62625 Microtubule-associated proteins 1A/1B light chain 3B 1.01e-03 1.46e-02 NA
2. P Q5YKI7 Putative gametogenetin-binding protein 1 3.39e-03 2.22e-12 NA
2. P A8FP19 50S ribosomal protein L23 7.80e-02 7.86e-04 NA
2. P P61961 Ubiquitin-fold modifier 1 3.42e-05 1.14e-05 NA
2. P Q09MB3 50S ribosomal protein L23, chloroplastic 6.22e-02 2.67e-04 NA
2. P A2YAG8 Ubiquitin-like protein ATG12 7.79e-05 5.74e-03 NA
2. P Q9ZI48 50S ribosomal protein L23 6.51e-02 6.92e-03 NA
2. P Q6L3C0 50S ribosomal protein L23, chloroplastic 6.43e-02 3.95e-04 NA
2. P A7FZ67 50S ribosomal protein L23 5.87e-02 4.65e-02 NA
2. P O52334 50S ribosomal protein L23 4.08e-02 1.84e-03 NA
2. P Q6EVY6 50S ribosomal protein L23, chloroplastic 6.36e-02 5.23e-03 NA
2. P Q803Y4 Ubiquitin-fold modifier 1 3.22e-05 5.35e-10 NA
2. P Q3ZJ88 50S ribosomal protein L23, chloroplastic 6.09e-02 7.05e-03 NA
2. P B3WAL5 50S ribosomal protein L23 5.80e-02 2.62e-02 NA
2. P C0MCB2 50S ribosomal protein L23 6.96e-02 3.73e-02 NA
2. P Q85WY6 50S ribosomal protein L23, chloroplastic 6.75e-02 6.97e-05 NA
2. P Q5HS92 50S ribosomal protein L23 7.75e-02 1.80e-03 NA
2. P Q5I132 Uncharacterized protein M4 NA 4.16e-04 NA
2. P Q8WHY0 50S ribosomal protein L23, chloroplastic 5.09e-02 9.31e-03 NA
2. P Q6DJH5 UPF0538 protein C2orf76 homolog 3.39e-03 1.91e-02 NA
2. P O62961 50S ribosomal protein L23, chloroplastic 6.66e-02 2.07e-04 NA
2. P Q3E8A8 Putative small ubiquitin-related modifier 7 2.84e-06 4.10e-06 NA
2. P Q9Y7L9 Uncharacterized protein C685.08 7.20e-04 6.90e-05 NA
2. P Q3V4X2 50S ribosomal protein L23, chloroplastic 6.13e-02 6.99e-03 NA
2. P B3EGY8 50S ribosomal protein L23 7.60e-02 1.64e-03 NA
2. P A3CK65 50S ribosomal protein L23 6.85e-02 1.73e-02 NA
2. P A3DJH4 50S ribosomal protein L23 6.18e-02 5.14e-05 NA
2. P Q2L943 50S ribosomal protein L23, chloroplastic 6.27e-02 1.19e-02 NA
2. P P0C451 50S ribosomal protein L23, chloroplastic 6.26e-02 4.93e-04 NA
2. P B3QR78 50S ribosomal protein L23 7.41e-02 2.64e-04 NA
2. P Q0TMP8 50S ribosomal protein L23 5.25e-02 9.14e-03 NA
2. P B2G8X6 50S ribosomal protein L23 5.83e-02 1.57e-03 NA
2. P Q9MAB9 Membrane-anchored ubiquitin-fold protein 1 2.09e-03 3.10e-02 NA
2. P Q6YXK5 50S ribosomal protein L23, chloroplastic 5.82e-02 7.81e-03 NA
2. P Q69NP0 Ubiquitin-like protein ATG12 7.49e-05 5.74e-03 NA
2. P Q661E0 50S ribosomal protein L23 6.18e-02 9.38e-04 NA
2. P Q6Z8K4 Membrane-anchored ubiquitin-fold protein 3 2.82e-03 3.19e-05 NA
2. P Q0P7S6 50S ribosomal protein L23 7.32e-02 1.80e-03 NA
2. P Q67UI2 Membrane-anchored ubiquitin-fold protein 2 1.40e-02 8.87e-05 NA
2. P O35972 39S ribosomal protein L23, mitochondrial 4.09e-02 4.19e-06 NA
2. P B5ZB42 50S ribosomal protein L23 4.98e-02 6.02e-03 NA
2. P A0A378 50S ribosomal protein L23, chloroplastic 5.12e-02 6.13e-04 NA
2. P Q3KRA6 UPF0538 protein C2orf76 3.23e-03 8.64e-03 NA
2. P Q2RFP9 50S ribosomal protein L23 4.89e-02 4.94e-02 NA
2. P B9L6N1 50S ribosomal protein L23 7.59e-02 1.47e-03 NA
2. P Q6L0P8 30S ribosomal protein S24e 6.90e-02 4.24e-04 NA
2. P Q046C3 50S ribosomal protein L23 5.60e-02 1.24e-04 NA
2. P Q88XY4 50S ribosomal protein L23 5.36e-02 6.02e-05 NA
2. P B3EP59 50S ribosomal protein L23 6.34e-02 1.23e-05 NA
2. P A6QCQ0 50S ribosomal protein L23 8.01e-02 1.84e-03 NA
2. P A4XLS8 50S ribosomal protein L23 5.05e-02 2.62e-02 NA
2. P Q18CF8 50S ribosomal protein L23 4.87e-02 2.64e-02 NA
2. P A9ETE3 50S ribosomal protein L23 5.96e-02 3.30e-02 NA
2. P Q0SQE6 50S ribosomal protein L23 5.28e-02 9.14e-03 NA
2. P Q06R67 50S ribosomal protein L23, chloroplastic 6.14e-02 8.03e-03 NA
2. P Q5PU89 Ubiquitin-fold modifier 1 9.41e-06 2.34e-06 NA
2. P Q71UE8 NEDD8 3.23e-07 9.29e-06 NA
2. P Q4R4I2 Ubiquitin-fold modifier 1 2.05e-05 1.14e-05 NA
2. P B9KEE2 50S ribosomal protein L23 7.82e-02 5.55e-04 NA
2. P Q32KX9 UPF0538 protein C2orf76 homolog 3.44e-03 1.70e-04 NA
2. P Q8TRU5 50S ribosomal protein L23 6.18e-02 1.32e-03 NA
2. P A5I7K4 50S ribosomal protein L23 5.87e-02 4.65e-02 NA
2. P B9DYB1 50S ribosomal protein L23 5.58e-02 7.39e-03 NA
2. P Q85FI0 50S ribosomal protein L23, chloroplastic 7.19e-02 6.19e-03 NA
2. P Q00457 Toluene-4-monooxygenase system, hydroxylase component subunit gamma 4.21e-04 1.13e-02 NA
2. P B0WK43 Ubiquitin-fold modifier 1 1.68e-05 5.23e-03 NA
2. P Q7MSL3 ATP-dependent Clp protease adapter protein ClpS 2.04e-01 1.41e-02 NA
2. P Q8GWJ6 Membrane-anchored ubiquitin-fold protein 6 1.35e-02 5.55e-04 NA
2. P B3H5R8 Putative small ubiquitin-related modifier 8 5.15e-05 3.35e-06 NA
2. P A0A2R8Y7D0 Ubiquitin domain-containing protein TINCR 5.88e-05 8.77e-09 NA
2. P B5FWC0 39S ribosomal protein L23, mitochondrial 9.71e-02 2.42e-06 NA
2. P P55812 Ubiquitin-like protein FUBI 2.24e-06 2.38e-03 NA
2. P A8Q8M5 Ubiquitin-fold modifier 1 2.74e-05 1.97e-06 NA
2. P Q06GJ6 50S ribosomal protein L23, chloroplastic 6.04e-02 1.82e-03 NA
2. P Q5XIF4 Small ubiquitin-related modifier 3 5.05e-06 3.50e-09 NA
2. P Q8LCS8 Membrane-anchored ubiquitin-fold protein 2 1.15e-02 3.73e-03 NA
2. P Q9D7A6 Signal recognition particle 19 kDa protein 3.69e-01 4.99e-02 NA
2. P Q9VJ33 NEDD8 1.91e-07 2.10e-05 NA
2. P Q7XRU4 Membrane-anchored ubiquitin-fold protein 4 2.39e-02 1.05e-04 NA
2. P P35545 Ubiquitin-like protein FUBI 2.35e-06 3.39e-03 NA
2. P C1BJ98 Ubiquitin-fold modifier 1 6.68e-05 5.45e-11 NA
2. P A1E9W7 50S ribosomal protein L23-B, chloroplastic 7.46e-02 3.95e-04 NA
2. P Q9FLP6 Small ubiquitin-related modifier 2 2.88e-05 5.66e-07 NA
2. P A7H654 50S ribosomal protein L23 7.68e-02 5.50e-04 NA
2. P Q8XHS5 50S ribosomal protein L23 5.20e-02 9.14e-03 NA
2. P Q68RU3 50S ribosomal protein L23, chloroplastic 6.08e-02 2.38e-03 NA
2. P Q2MIE5 50S ribosomal protein L23, chloroplastic 6.03e-02 1.41e-03 NA
2. P A8ESU5 50S ribosomal protein L23 7.05e-02 7.22e-07 NA
2. P B1KSM3 50S ribosomal protein L23 5.85e-02 4.65e-02 NA
2. P Q16540 39S ribosomal protein L23, mitochondrial 5.57e-02 2.74e-05 NA
2. P Q5RBS7 UPF0538 protein C2orf76 homolog 3.50e-03 1.77e-03 NA
2. P Q2MI58 50S ribosomal protein L23, chloroplastic 6.56e-02 1.41e-03 NA
2. P Q3BAH2 50S ribosomal protein L23, chloroplastic 6.79e-02 8.49e-03 NA
2. P Q4JT49 50S ribosomal protein L23 3.82e-02 1.89e-03 NA
2. P Q03PV9 50S ribosomal protein L23 5.43e-02 1.03e-02 NA
2. P P29595 NEDD8 3.15e-07 9.29e-06 NA
2. P Q332R6 50S ribosomal protein L23, chloroplastic 6.01e-02 9.20e-04 NA
2. P Q1KXP5 50S ribosomal protein L23, chloroplastic 6.08e-02 9.76e-04 NA
2. P Q94EY2 Ubiquitin-fold modifier 1 1.15e-05 1.63e-06 NA
2. P Q97BH3 30S ribosomal protein S24e 6.30e-02 1.93e-03 NA
2. P Q9FLP5 Small ubiquitin-related modifier 3 1.69e-04 9.57e-09 NA
2. P P94269 50S ribosomal protein L23 5.35e-02 3.39e-03 NA
2. P Q09JK2 Ubiquitin-fold modifier 1 1.60e-05 2.81e-07 NA
2. P Q2SIW7 YcgL domain-containing protein HCH_02617 2.54e-01 8.51e-06 NA
2. P Q9W021 39S ribosomal protein L23, mitochondrial 5.08e-02 2.60e-05 NA
2. P O26267 Signal recognition particle 19 kDa protein 2.68e-01 4.33e-03 NA
2. P A4FVY0 50S ribosomal protein L23 4.68e-02 1.39e-02 NA
2. P A6LPR3 50S ribosomal protein L23 5.06e-02 4.10e-03 NA
2. P A1EA51 50S ribosomal protein L23-B, chloroplastic 7.45e-02 1.16e-04 NA
2. P Q46FS6 30S ribosomal protein S24e 8.33e-02 1.27e-02 NA
2. P Q9SH14 Membrane-anchored ubiquitin-fold protein 5 8.43e-03 1.15e-03 NA
2. P Q54R16 UPF0538 protein 2.00e-03 1.16e-02 NA
2. P Q09FY4 50S ribosomal protein L23, chloroplastic 6.05e-02 7.05e-04 NA
2. P Q17ZD6 50S ribosomal protein L23 8.09e-02 3.93e-02 NA
2. P P55854 Small ubiquitin-related modifier 3 6.10e-07 1.55e-04 NA
2. P Q1ACF5 50S ribosomal protein L23, chloroplastic 5.51e-02 9.31e-03 NA
2. P P34661 Ubiquitin-fold modifier 1 1.14e-05 1.88e-02 NA
2. P A4SCR1 50S ribosomal protein L23 9.49e-02 8.14e-06 NA
2. P P61845 50S ribosomal protein L23, chloroplastic 5.19e-02 5.67e-04 NA
2. P Q85BJ7 50S ribosomal protein L23, chloroplastic 5.20e-02 3.59e-03 NA
2. P Q1GBL6 50S ribosomal protein L23 5.85e-02 5.84e-04 NA
2. P A6VHD4 50S ribosomal protein L23 4.70e-02 1.86e-02 NA
2. P Q7PXE2 Ubiquitin-fold modifier 1 2.15e-05 2.90e-06 NA
2. P B4GBR1 Ubiquitin-fold modifier 1 2.55e-05 3.45e-02 NA
2. P A7NR61 50S ribosomal protein L23 5.07e-02 3.02e-02 NA
2. P Q04G83 50S ribosomal protein L23 5.33e-02 6.01e-04 NA
2. P Q14F96 50S ribosomal protein L23, chloroplastic 6.21e-02 1.19e-03 NA
2. P P0C2F1 Ubiquitin-like protein FUBI 1.82e-06 3.26e-03 NA
2. P Q8YPI1 50S ribosomal protein L23 1.17e-02 4.04e-02 NA
2. P O14037 UPF0538 protein C2C4.04c 2.44e-03 3.49e-03 NA
2. P B8I7Y1 50S ribosomal protein L23 6.05e-02 3.28e-06 NA
2. P B8D946 Protein RnfH 9.27e-04 2.21e-02 NA
2. P Q6LX09 50S ribosomal protein L23 4.74e-02 3.10e-02 NA
2. P A1E9T3 50S ribosomal protein L23-A, chloroplastic 1.24e-01 2.69e-02 NA
2. P A0LRM2 50S ribosomal protein L23 5.77e-02 6.86e-03 NA
2. P Q0G9Q0 50S ribosomal protein L23, chloroplastic 6.07e-02 6.20e-04 NA
2. P B4U746 50S ribosomal protein L23 6.51e-02 1.60e-02 NA
2. P Q9LVK3 Ubiquitin-like protein ATG12B 1.67e-04 1.30e-03 NA
2. P Q97ZQ4 50S ribosomal protein L23 5.74e-02 8.97e-03 NA
2. P Q04C13 50S ribosomal protein L23 5.87e-02 5.84e-04 NA
2. P B3QY26 50S ribosomal protein L23 5.59e-02 2.14e-03 NA
2. P P62868 Ubiquitin-like protein FUBI 2.39e-06 3.39e-03 NA
2. P Q9CA23 Ubiquitin-fold modifier 1 5.00e-05 6.59e-11 NA
2. P A8D888 Ubiquitin-fold modifier 1 2.31e-05 7.50e-12 NA
2. P P61960 Ubiquitin-fold modifier 1 2.10e-05 1.14e-05 NA
2. P Q9K1I6 50S ribosomal protein L23 5.75e-02 7.39e-03 NA
2. P P52772 50S ribosomal protein L23, chloroplastic 5.79e-02 1.32e-04 NA
2. P Q0ZIV5 50S ribosomal protein L23, chloroplastic 6.16e-02 1.16e-03 NA
2. P A0ZZ77 50S ribosomal protein L23, chloroplastic 6.28e-02 1.19e-02 NA
2. P B3DL37 Ubiquitin-fold modifier 1 1.57e-05 8.68e-05 NA
2. P Q63750 39S ribosomal protein L23, mitochondrial 3.92e-02 3.79e-06 NA
2. P Q8PZ95 30S ribosomal protein S24e 3.04e-02 2.89e-02 NA
2. P B8GFC3 30S ribosomal protein S24e 2.94e-02 9.94e-05 NA
2. P Q176V0 Ubiquitin-fold modifier 1 2.55e-05 1.40e-04 NA
2. P B2UYB2 50S ribosomal protein L23 4.68e-02 4.13e-03 NA
2. P Q3MFB9 50S ribosomal protein L23 1.18e-02 1.68e-02 NA
2. P B2GDW7 50S ribosomal protein L23 5.48e-02 3.57e-04 NA
2. P Q5RJW4 Ubiquitin-fold modifier 1 1.58e-05 8.68e-05 NA
2. P A7HZK8 50S ribosomal protein L23 7.35e-02 6.86e-03 NA
2. P Q034Y5 50S ribosomal protein L23 7.68e-02 2.62e-02 NA
2. P C1FMU9 50S ribosomal protein L23 5.86e-02 4.65e-02 NA
2. P P61846 50S ribosomal protein L23, chloroplastic 5.15e-02 5.67e-04 NA
2. P Q5RBR1 Signal recognition particle 19 kDa protein 3.95e-01 4.53e-02 NA
2. P A1EA17 50S ribosomal protein L23-A, chloroplastic 7.69e-02 3.80e-04 NA
2. P P62865 Ubiquitin-like protein FUBI 1.63e-06 7.52e-03 NA
2. P Q9LSD8 Membrane-anchored ubiquitin-fold protein 4 9.17e-03 2.23e-03 NA
2. P A5UDU5 50S ribosomal protein L23 6.05e-02 1.41e-02 NA
2. P Q9Z172 Small ubiquitin-related modifier 3 3.66e-05 9.98e-10 NA
2. P P10143 50S ribosomal protein L23 5.14e-02 3.57e-02 NA
2. P Q9B1K8 50S ribosomal protein L23, chloroplastic 6.04e-02 1.57e-03 NA
2. P A7GJ72 50S ribosomal protein L23 5.91e-02 4.65e-02 NA
2. P Q5BJP3 Ubiquitin-fold modifier 1 1.74e-05 1.06e-04 NA
2. P Q2FU93 50S ribosomal protein L23 8.83e-02 3.33e-03 NA
2. P B2TIH7 50S ribosomal protein L23 5.93e-02 2.55e-03 NA
2. P Q06SH7 50S ribosomal protein L23, chloroplastic 6.17e-02 3.68e-04 NA
2. P Q3C1N5 50S ribosomal protein L23, chloroplastic 6.12e-02 1.41e-03 NA
2. P Q9CRW3 UPF0538 protein C2orf76 homolog 3.61e-03 1.72e-04 NA
2. P Q74L87 50S ribosomal protein L23 5.54e-02 2.72e-04 NA
2. P Q30ZJ9 ATP-dependent Clp protease adapter protein ClpS 1.45e-01 1.81e-02 NA
2. P A0PXU8 50S ribosomal protein L23 4.77e-02 4.76e-03 NA
2. P Q5R4N5 Ubiquitin-fold modifier 1 1.95e-05 1.14e-05 NA
2. P A7H109 50S ribosomal protein L23 7.19e-02 1.32e-02 NA
2. P Q8U442 30S ribosomal protein S24e 2.72e-02 2.89e-04 NA
2. P B9MKH9 50S ribosomal protein L23 5.07e-02 9.48e-03 NA
2. P Q7M8D6 50S ribosomal protein L23 8.23e-02 3.07e-02 NA
2. P Q75GT2 Membrane-anchored ubiquitin-fold protein 1 5.89e-03 3.76e-03 NA
2. P C3KVP9 50S ribosomal protein L23 5.85e-02 4.65e-02 NA
2. P P06391 50S ribosomal protein L23, chloroplastic 6.11e-02 1.41e-03 NA
2. P P69668 50S ribosomal protein L23, chloroplastic 7.44e-02 1.16e-04 NA
2. P Q04353 Uncharacterized protein CA_C3711 4.00e-04 2.56e-07 NA
2. P Q4PLJ0 NEDD8 2.78e-07 2.43e-04 NA
2. P P47399 50S ribosomal protein L23 6.49e-02 3.47e-07 NA
2. P A6VJ77 30S ribosomal protein S24e 1.03e-02 3.97e-02 NA
2. P C4LL50 50S ribosomal protein L23 3.90e-02 1.20e-03 NA
2. P Q4VZK6 50S ribosomal protein L23, chloroplastic 6.13e-02 1.16e-03 NA
2. P Q70XV3 50S ribosomal protein L23, chloroplastic 7.65e-02 7.59e-03 NA
2. P B4SBU9 50S ribosomal protein L23 8.40e-02 2.29e-02 NA
2. P Q66IB8 UPF0538 protein C2orf76 homolog 4.71e-03 6.46e-06 NA
2. P A1AVK2 50S ribosomal protein L23 4.86e-02 4.81e-02 NA
2. P C6A0F5 30S ribosomal protein S24e 3.07e-02 1.51e-02 NA
2. P P57111 Protein RnfH 4.66e-04 2.48e-02 NA
2. P B1IGF2 50S ribosomal protein L23 5.85e-02 4.65e-02 NA
3. B Q6AI12 Ankyrin repeat domain-containing protein 40 8.80e-04 NA 8.10e-40
3. B Q5SUE8 Ankyrin repeat domain-containing protein 40 2.75e-04 NA 5.63e-41