Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q8C0J6
(Ankyrin repeat domain-containing protein SOWAHC) with a FATCAT P-Value: 9.01e-09 and RMSD of 5.96 angstrom. The sequence alignment identity is 70.3%.
Structural alignment shown in left. Query protein Q53LP3 colored as red in alignment, homolog Q8C0J6 colored as blue.
Query protein Q53LP3 is also shown in right top, homolog Q8C0J6 showed in right bottom. They are colored based on secondary structures.
Q53LP3 MEGPAEWGPEAALGPEAVLRFLAERGGRALHAELVQHFRGALGGEPEQRARARAHFKELVNAVATVRVDPADGAKYVHLKKRFCEGPSEP-----SGDPP 95 Q8C0J6 MEGSLE------LSSEAILRFLAERGGRAGHSELVQHFRDVLGGQREQRTRARERFKELVNAVATVRTDPADGTKYVHLKKRFCTGDSPPLEAKLPREPP 94 Q53LP3 RIQVTAEPEAPDGPAGPEARDRLPDAAAPE-SLPGQGRELGEGEPPAPAHWPPLSAGARRKNS-RRDVQPLPRTPAPGPSEDLELPPHGCEEADRGSSLV 193 Q8C0J6 RIEVTEEPQVPDLAAEPCEGSQLQE-ANPQLSL-GLGGEVSDQEPPAPA-----QGGAQGKDSPPQEVEAVSWASGPGSSENLKLPPQG--EAEGGSSPS 185 Q53LP3 GATAQRPARQNLRDLVMGSSPQLKRSVCPGGSSPGSSSGGGRGRGGGDSDSASVASSSAEEESSGGGSVTLDPLEHAWMLSASDGKWDSLEGLLTCEPGL 293 Q8C0J6 GPNTPRSARQNFRDLVLGSSPQLKRSV--G---PGDGNAGGRSRGGGDSDTASLASSSAEEESSVGASVTLDPLDHAWMLSASEGKWDSLEGLLTCEPGL 280 Q53LP3 LVKRDFITGFTCLHWAAKHGRQELLAMLVNFANKHQLPVNIDARTSGGYTALHLAAMHGHVEVVKLLVGAYDADVDIRDYSGKKASQYLSRSIAEEIKNL 393 Q8C0J6 LSKRDFITGFTCLHWAAKHGRQELLAMLVNFATKHQLPVNINAKSSGGYTALHLAAMHGHVEVVKLLVGAYDADVDIRDYSGRKASQYLSESIAEEIKNL 380 Q53LP3 VGALDEGDGESAAGSGGGRWRLSKVLPSHLITYKLSHALEDGGDHHHHHHSAEGWVGG-KAKDPGRKASGSSSGRIKPRLNKIRFRTQIVHTTPSFRDPE 492 Q8C0J6 VGALDEDDGDSPAARGGGRWRLSKVLPSH-ITHKLSPVVEDGAE--LHHHVPEGWTGGSKAKDSGRKASGSSSGRMKPRLNKIRFRTQIIHTTPSFRD-A 476 Q53LP3 QP-L-EGRGEEGVGEERPVKGH-SPFTLRPKSNVFG 525 Q8C0J6 KPTLEEGEEEEEEEEERSLRGYSSSFKLRPKSNVFG 512
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0051059 | NF-kappaB binding |
| 1. PB | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 1. PB | GO:0030907 | MBF transcription complex |
| 1. PB | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 1. PB | GO:0033309 | SBF transcription complex |
| 1. PB | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 1. PB | GO:0007253 | cytoplasmic sequestering of NF-kappaB |
| 1. PB | GO:0035994 | response to muscle stretch |
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:0031674 | I band |
| 2. P | GO:0030198 | extracellular matrix organization |
| 2. P | GO:0001227 | DNA-binding transcription repressor activity, RNA polymerase II-specific |
| 2. P | GO:0002455 | humoral immune response mediated by circulating immunoglobulin |
| 2. P | GO:1901222 | regulation of NIK/NF-kappaB signaling |
| 2. P | GO:0042771 | intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator |
| 2. P | GO:0045662 | negative regulation of myoblast differentiation |
| 2. P | GO:0032496 | response to lipopolysaccharide |
| 2. P | GO:0032717 | negative regulation of interleukin-8 production |
| 2. P | GO:0032720 | negative regulation of tumor necrosis factor production |
| 2. P | GO:1900127 | positive regulation of hyaluronan biosynthetic process |
| 2. P | GO:0071359 | cellular response to dsRNA |
| 2. P | GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress |
| 2. P | GO:0071212 | subsynaptic reticulum |
| 2. P | GO:0003713 | transcription coactivator activity |
| 2. P | GO:0007399 | nervous system development |
| 2. P | GO:0048511 | rhythmic process |
| 2. P | GO:0008307 | structural constituent of muscle |
| 2. P | GO:0071931 | positive regulation of transcription involved in G1/S transition of mitotic cell cycle |
| 2. P | GO:0001228 | DNA-binding transcription activator activity, RNA polymerase II-specific |
| 2. P | GO:0042088 | T-helper 1 type immune response |
| 2. P | GO:0046843 | dorsal appendage formation |
| 2. P | GO:0032733 | positive regulation of interleukin-10 production |
| 2. P | GO:0000791 | euchromatin |
| 2. P | GO:0045751 | negative regulation of Toll signaling pathway |
| 2. P | GO:0005634 | nucleus |
| 2. P | GO:2000630 | positive regulation of miRNA metabolic process |
| 2. P | GO:0030435 | sporulation resulting in formation of a cellular spore |
| 2. P | GO:0002789 | negative regulation of antifungal peptide production |
| 2. P | GO:0042805 | actinin binding |
| 2. P | GO:0043422 | protein kinase B binding |
| 2. P | GO:0002467 | germinal center formation |
| 2. P | GO:0046426 | negative regulation of receptor signaling pathway via JAK-STAT |
| 2. P | GO:0000785 | chromatin |
| 2. P | GO:0051101 | regulation of DNA binding |
| 2. P | GO:0000083 | regulation of transcription involved in G1/S transition of mitotic cell cycle |
| 2. P | GO:0045611 | negative regulation of hemocyte differentiation |
| 2. P | GO:0031594 | neuromuscular junction |
| 2. P | GO:0033257 | Bcl3/NF-kappaB2 complex |
| 2. P | GO:0006357 | regulation of transcription by RNA polymerase II |
| 2. P | GO:0032695 | negative regulation of interleukin-12 production |
| 2. P | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding |
| 2. P | GO:1904385 | cellular response to angiotensin |
| 2. P | GO:1990837 | sequence-specific double-stranded DNA binding |
| 2. P | GO:0061408 | positive regulation of transcription from RNA polymerase II promoter in response to heat stress |
| 2. P | GO:0071316 | cellular response to nicotine |
| 2. P | GO:0000981 | DNA-binding transcription factor activity, RNA polymerase II-specific |
| 2. P | GO:0002315 | marginal zone B cell differentiation |
| 2. P | GO:0010225 | response to UV-C |
| 2. P | GO:0009950 | dorsal/ventral axis specification |
| 2. P | GO:0010956 | negative regulation of calcidiol 1-monooxygenase activity |
| 2. P | GO:0048536 | spleen development |
| 2. P | GO:0048315 | conidium formation |
| 2. P | GO:0030330 | DNA damage response, signal transduction by p53 class mediator |
| 2. P | GO:0048535 | lymph node development |
| 2. P | GO:0034097 | response to cytokine |
| 2. P | GO:0002268 | follicular dendritic cell differentiation |
| 2. P | GO:0042832 | defense response to protozoan |
| 2. P | GO:0045064 | T-helper 2 cell differentiation |
| 2. P | GO:0051445 | regulation of meiotic cell cycle |
| 2. P | GO:0007568 | aging |
| 2. P | GO:0071354 | cellular response to interleukin-6 |
| 2. P | GO:0045893 | positive regulation of transcription, DNA-templated |
| 2. P | GO:0038061 | NIK/NF-kappaB signaling |
| 2. P | GO:0032996 | Bcl3-Bcl10 complex |
| 2. P | GO:0019730 | antimicrobial humoral response |
| 2. P | GO:0009303 | rRNA transcription |
| 2. P | GO:0010845 | positive regulation of reciprocal meiotic recombination |
| 3. B | GO:1903356 | positive regulation of distal tip cell migration |
| 3. B | GO:0071286 | cellular response to magnesium ion |
| 3. B | GO:0043198 | dendritic shaft |
| 3. B | GO:0030837 | negative regulation of actin filament polymerization |
| 3. B | GO:0042994 | cytoplasmic sequestering of transcription factor |
| 3. B | GO:0050775 | positive regulation of dendrite morphogenesis |
| 3. B | GO:0050729 | positive regulation of inflammatory response |
| 3. B | GO:0048709 | oligodendrocyte differentiation |
| 3. B | GO:0043034 | costamere |
| 3. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 3. B | GO:0001701 | in utero embryonic development |
| 3. B | GO:0016567 | protein ubiquitination |
| 3. B | GO:0036166 | phenotypic switching |
| 3. B | GO:0070563 | negative regulation of vitamin D receptor signaling pathway |
| 3. B | GO:0030334 | regulation of cell migration |
| 3. B | GO:0001756 | somitogenesis |
| 3. B | GO:0039022 | pronephric duct development |
| 3. B | GO:2001259 | positive regulation of cation channel activity |
| 3. B | GO:0021514 | ventral spinal cord interneuron differentiation |
| 3. B | GO:0006468 | protein phosphorylation |
| 3. B | GO:0045663 | positive regulation of myoblast differentiation |
| 3. B | GO:0018105 | peptidyl-serine phosphorylation |
| 3. B | GO:0014044 | Schwann cell development |
| 3. B | GO:0006306 | DNA methylation |
| 3. B | GO:0106310 | protein serine kinase activity |
| 3. B | GO:0046974 | histone methyltransferase activity (H3-K9 specific) |
| 3. B | GO:0018024 | histone-lysine N-methyltransferase activity |
| 3. B | GO:0042127 | regulation of cell population proliferation |
| 3. B | GO:0004842 | ubiquitin-protein transferase activity |
| 3. B | GO:0008021 | synaptic vesicle |
| 3. B | GO:0030018 | Z disc |
| 3. B | GO:0048259 | regulation of receptor-mediated endocytosis |
| 3. B | GO:0097431 | mitotic spindle pole |
| 3. B | GO:0003950 | NAD+ ADP-ribosyltransferase activity |
| 3. B | GO:0032956 | regulation of actin cytoskeleton organization |
| 3. B | GO:0036372 | opsin transport |
| 3. B | GO:0021519 | spinal cord association neuron specification |
| 3. B | GO:0021536 | diencephalon development |
| 3. B | GO:0036377 | arbuscular mycorrhizal association |
| 3. B | GO:0045669 | positive regulation of osteoblast differentiation |
| 3. B | GO:0099612 | protein localization to axon |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0071803 | positive regulation of podosome assembly |
| 3. B | GO:0034968 | histone lysine methylation |
| 3. B | GO:0016571 | histone methylation |
| 3. B | GO:0030054 | cell junction |
| 3. B | GO:0071260 | cellular response to mechanical stimulus |
| 3. B | GO:0010765 | positive regulation of sodium ion transport |
| 3. B | GO:0035304 | regulation of protein dephosphorylation |
| 3. B | GO:0018027 | peptidyl-lysine dimethylation |
| 3. B | GO:0061551 | trigeminal ganglion development |
| 3. B | GO:0035690 | |
| 3. B | GO:0010960 | magnesium ion homeostasis |
| 3. B | GO:0001650 | fibrillar center |
| 3. B | GO:0005547 | phosphatidylinositol-3,4,5-trisphosphate binding |
| 3. B | GO:0072659 | protein localization to plasma membrane |
| 3. B | GO:0086015 | SA node cell action potential |
| 3. B | GO:1990404 | protein ADP-ribosylase activity |
| 3. B | GO:0016328 | lateral plasma membrane |
| 3. B | GO:0036464 | cytoplasmic ribonucleoprotein granule |
| 3. B | GO:0003151 | outflow tract morphogenesis |
| 3. B | GO:0021675 | nerve development |
| 3. B | GO:0002039 | p53 binding |
| 3. B | GO:0000281 | mitotic cytokinesis |
| 3. B | GO:0001841 | neural tube formation |
| 3. B | GO:0080173 | male-female gamete recognition during double fertilization forming a zygote and endosperm |
| 3. B | GO:0048899 | anterior lateral line development |
| 3. B | GO:0033147 | negative regulation of intracellular estrogen receptor signaling pathway |
| 3. B | GO:0001222 | transcription corepressor binding |
| 3. B | GO:0007009 | plasma membrane organization |
| 3. B | GO:2000393 | negative regulation of lamellipodium morphogenesis |
| 3. B | GO:0043292 | contractile fiber |
| 3. B | GO:0043517 | positive regulation of DNA damage response, signal transduction by p53 class mediator |
| 3. B | GO:0019843 | rRNA binding |
| 3. B | GO:0010564 | regulation of cell cycle process |
| 3. B | GO:0048145 | regulation of fibroblast proliferation |
| 3. B | GO:0070212 | protein poly-ADP-ribosylation |
| 3. B | GO:0042417 | dopamine metabolic process |
| 3. B | GO:0034142 | toll-like receptor 4 signaling pathway |
| 3. B | GO:0018026 | peptidyl-lysine monomethylation |
| 3. B | GO:0007160 | cell-matrix adhesion |
| 3. B | GO:0032426 | stereocilium tip |
| 3. B | GO:0000151 | ubiquitin ligase complex |
| 3. B | GO:0019228 | neuronal action potential |
| 3. B | GO:1900119 | positive regulation of execution phase of apoptosis |
| 3. B | GO:0005654 | nucleoplasm |
| 3. B | GO:0021555 | midbrain-hindbrain boundary morphogenesis |
| 3. B | GO:0086046 | membrane depolarization during SA node cell action potential |
| 3. B | GO:0072073 | kidney epithelium development |
| 3. B | GO:0051569 | regulation of histone H3-K4 methylation |
| 3. B | GO:0005819 | spindle |
| 3. B | GO:0035023 | regulation of Rho protein signal transduction |
| 3. B | GO:0072357 | PTW/PP1 phosphatase complex |
| 3. B | GO:0009925 | basal plasma membrane |
| 3. B | GO:0009932 | cell tip growth |
| 3. B | GO:0043086 | negative regulation of catalytic activity |
| 3. B | GO:0022011 | myelination in peripheral nervous system |
| 3. B | GO:0005764 | lysosome |
| 3. B | GO:0010650 | positive regulation of cell communication by electrical coupling |
| 3. B | GO:0010313 | phytochrome binding |
| 3. B | GO:0045638 | negative regulation of myeloid cell differentiation |
| 3. B | GO:0000209 | protein polyubiquitination |
| 3. B | GO:0001947 | heart looping |
| 3. B | GO:0002027 | regulation of heart rate |
| 3. B | GO:0010638 | positive regulation of organelle organization |
| 3. B | GO:0061000 | negative regulation of dendritic spine development |
| 3. B | GO:0005178 | integrin binding |
| 3. B | GO:2000178 | negative regulation of neural precursor cell proliferation |
| 3. B | GO:0060998 | regulation of dendritic spine development |
| 3. B | GO:0044325 | transmembrane transporter binding |
| 3. B | GO:0008593 | regulation of Notch signaling pathway |
| 3. B | GO:0006897 | endocytosis |
| 3. B | GO:0070650 | actin filament bundle distribution |
| 3. B | GO:0098904 | regulation of AV node cell action potential |
| 3. B | GO:0072116 | pronephros formation |
| 3. B | GO:0055008 | cardiac muscle tissue morphogenesis |
| 3. B | GO:0006887 | exocytosis |
| 3. B | GO:0071314 | cellular response to cocaine |
| 3. B | GO:2000096 | positive regulation of Wnt signaling pathway, planar cell polarity pathway |
| 3. B | GO:0046875 | ephrin receptor binding |
| 3. B | GO:0010366 | negative regulation of ethylene biosynthetic process |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:1904901 | positive regulation of myosin II filament organization |
| 3. B | GO:0098907 | regulation of SA node cell action potential |
| 3. B | GO:0003408 | optic cup formation involved in camera-type eye development |
| 3. B | GO:0070528 | protein kinase C signaling |
| 3. B | GO:0001558 | regulation of cell growth |
| 3. B | GO:0046928 | regulation of neurotransmitter secretion |
| 3. B | GO:0005516 | calmodulin binding |
| 3. B | GO:1900026 | positive regulation of substrate adhesion-dependent cell spreading |
| 3. B | GO:0001568 | blood vessel development |
| 3. B | GO:0003677 | DNA binding |
| 3. B | GO:0010875 | positive regulation of cholesterol efflux |
| 3. B | GO:0045746 | negative regulation of Notch signaling pathway |
| 3. B | GO:0030155 | regulation of cell adhesion |
| 3. B | GO:0086014 | atrial cardiac muscle cell action potential |
| 3. B | GO:0097604 | temperature-gated cation channel activity |
| 3. B | GO:0070213 | protein auto-ADP-ribosylation |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0051973 | positive regulation of telomerase activity |
| 3. B | GO:0030507 | spectrin binding |
| 3. B | GO:0043330 | response to exogenous dsRNA |
| 3. B | GO:0099523 | presynaptic cytosol |
| 3. B | GO:0048812 | neuron projection morphogenesis |
| 3. B | GO:0033292 | T-tubule organization |
| 3. B | GO:0005769 | early endosome |
| 3. B | GO:1904908 | negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric |
| 3. B | GO:0071356 | cellular response to tumor necrosis factor |
| 3. B | GO:0051117 | ATPase binding |
| 3. B | GO:0061629 | RNA polymerase II-specific DNA-binding transcription factor binding |
| 3. B | GO:0070936 | protein K48-linked ubiquitination |
| 3. B | GO:0070682 | proteasome regulatory particle assembly |
| 3. B | GO:1904108 | protein localization to ciliary inversin compartment |
| 3. B | GO:0070412 | R-SMAD binding |
| 3. B | GO:0006915 | apoptotic process |
| 3. B | GO:0051017 | actin filament bundle assembly |
| 3. B | GO:0032495 | response to muramyl dipeptide |
| 3. B | GO:0048148 | behavioral response to cocaine |
| 3. B | GO:0106311 | |
| 3. B | GO:0071889 | 14-3-3 protein binding |
| 3. B | GO:0006606 | protein import into nucleus |
| 3. B | GO:0014069 | postsynaptic density |
| 3. B | GO:0043406 | positive regulation of MAP kinase activity |
| 3. B | GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway |
| 3. B | GO:0001954 | positive regulation of cell-matrix adhesion |
| 3. B | GO:0090521 | glomerular visceral epithelial cell migration |
| 3. B | GO:0031436 | BRCA1-BARD1 complex |
| 3. B | GO:0051726 | regulation of cell cycle |
| 3. B | GO:0035844 | cloaca development |
| 3. B | GO:0014912 | negative regulation of smooth muscle cell migration |
| 3. B | GO:0006469 | negative regulation of protein kinase activity |
| 3. B | GO:0071407 | cellular response to organic cyclic compound |
| 3. B | GO:0099092 | postsynaptic density, intracellular component |
| 3. B | GO:0045211 | postsynaptic membrane |
| 3. B | GO:0043266 | regulation of potassium ion transport |
| 3. B | GO:0010976 | positive regulation of neuron projection development |
| 3. B | GO:0090083 | regulation of inclusion body assembly |
| 3. B | GO:1902412 | regulation of mitotic cytokinesis |
| 3. B | GO:0050955 | thermoception |
| 3. B | GO:0030017 | sarcomere |
| 3. B | GO:0032270 | positive regulation of cellular protein metabolic process |
| 3. B | GO:1902902 | negative regulation of autophagosome assembly |
| 3. B | GO:0043491 | protein kinase B signaling |
| 3. B | GO:0050772 | positive regulation of axonogenesis |
| 3. B | GO:0016055 | Wnt signaling pathway |
| 3. B | GO:2000651 | positive regulation of sodium ion transmembrane transporter activity |
| 3. B | GO:0048815 | hermaphrodite genitalia morphogenesis |
| 3. B | GO:0061195 | taste bud formation |
| 3. B | GO:0032288 | myelin assembly |
| 3. B | GO:0005622 | intracellular anatomical structure |
| 3. B | GO:0140031 | phosphorylation-dependent protein binding |
| 3. B | GO:0001934 | positive regulation of protein phosphorylation |
| 3. B | GO:0086091 | regulation of heart rate by cardiac conduction |
| 3. B | GO:0031670 | cellular response to nutrient |
| 3. B | GO:0019208 | phosphatase regulator activity |
| 3. B | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 3. B | GO:0030315 | T-tubule |
| 3. B | GO:0055117 | regulation of cardiac muscle contraction |
| 3. B | GO:0071345 | cellular response to cytokine stimulus |
| 3. B | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 3. B | GO:0030424 | axon |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 3. B | GO:0043069 | negative regulation of programmed cell death |
| 3. B | GO:1902260 | negative regulation of delayed rectifier potassium channel activity |
| 3. B | GO:0010888 | negative regulation of lipid storage |
| 3. B | GO:0031430 | M band |
| 3. B | GO:0045995 | regulation of embryonic development |
| 3. B | GO:0070198 | protein localization to chromosome, telomeric region |
| 3. B | GO:0031253 | cell projection membrane |
| 3. B | GO:0010761 | fibroblast migration |
| 3. B | GO:0007030 | Golgi organization |
| 3. B | GO:0031672 | A band |
| 3. B | GO:0045838 | positive regulation of membrane potential |
| 3. B | GO:0098910 | regulation of atrial cardiac muscle cell action potential |
| 3. B | GO:0043194 | axon initial segment |
| 3. B | GO:0036371 | protein localization to T-tubule |
| 3. B | GO:0048662 | negative regulation of smooth muscle cell proliferation |
| 3. B | GO:0099527 | postsynapse to nucleus signaling pathway |
| 3. B | GO:0044030 | regulation of DNA methylation |
| 3. B | GO:0070742 | C2H2 zinc finger domain binding |
| 3. B | GO:0016279 | protein-lysine N-methyltransferase activity |
| 3. B | GO:0072332 | intrinsic apoptotic signaling pathway by p53 class mediator |
| 3. B | GO:0010424 | DNA methylation on cytosine within a CG sequence |
| 3. B | GO:0010745 | negative regulation of macrophage derived foam cell differentiation |
| 3. B | GO:1904355 | positive regulation of telomere capping |
| 3. B | GO:0014731 | spectrin-associated cytoskeleton |
| 3. B | GO:0033270 | paranode region of axon |
| 3. B | GO:0098978 | glutamatergic synapse |
| 3. B | GO:0072114 | pronephros morphogenesis |
| 3. B | GO:0071560 | cellular response to transforming growth factor beta stimulus |
| 3. B | GO:0045184 | establishment of protein localization |
| 3. B | GO:0061630 | ubiquitin protein ligase activity |
| 3. B | GO:0017124 | SH3 domain binding |
| 3. B | GO:0097543 | ciliary inversin compartment |
| 3. B | GO:0010882 | regulation of cardiac muscle contraction by calcium ion signaling |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:2001257 | regulation of cation channel activity |
| 3. B | GO:0098871 | postsynaptic actin cytoskeleton |
| 3. B | GO:0097435 | supramolecular fiber organization |
| 3. B | GO:0016323 | basolateral plasma membrane |
| 3. B | GO:0097120 | receptor localization to synapse |
| 3. B | GO:0046822 | regulation of nucleocytoplasmic transport |
| 3. B | GO:0014704 | intercalated disc |
| 3. B | GO:0007098 | centrosome cycle |
| 3. B | GO:0019901 | protein kinase binding |
| 3. B | GO:0099519 | dense core granule cytoskeletal transport |
| 3. B | GO:0007219 | Notch signaling pathway |
| 3. B | GO:0001658 | branching involved in ureteric bud morphogenesis |
| 3. B | GO:0009610 | response to symbiotic fungus |
| 3. B | GO:0035265 | organ growth |
| 3. B | GO:0010881 | regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:0021546 | rhombomere development |
| 3. B | GO:0003190 | atrioventricular valve formation |
| 3. B | GO:0070427 | nucleotide-binding oligomerization domain containing 1 signaling pathway |
| 3. B | GO:0030030 | cell projection organization |
| 3. B | GO:0050931 | pigment cell differentiation |
| 3. B | GO:0043001 | Golgi to plasma membrane protein transport |
| 3. B | GO:0046976 | histone methyltransferase activity (H3-K27 specific) |
| 3. B | GO:0032212 | positive regulation of telomere maintenance via telomerase |
| 3. B | GO:1905274 | regulation of modification of postsynaptic actin cytoskeleton |
| 3. B | GO:0007569 | cell aging |
| 3. B | GO:0007130 | synaptonemal complex assembly |
| 3. B | GO:0005856 | cytoskeleton |
| 3. B | GO:0061001 | regulation of dendritic spine morphogenesis |
| 3. B | GO:0060236 | regulation of mitotic spindle organization |
| 3. B | GO:0043195 | terminal bouton |
| 3. B | GO:2000279 | negative regulation of DNA biosynthetic process |
| 3. B | GO:0032580 | Golgi cisterna membrane |
| 3. B | GO:0035914 | skeletal muscle cell differentiation |
| 3. B | GO:0061025 | membrane fusion |
| 3. B | GO:0016529 | sarcoplasmic reticulum |
| 3. B | GO:0050968 | detection of chemical stimulus involved in sensory perception of pain |
| 3. B | GO:0007229 | integrin-mediated signaling pathway |
| 3. B | GO:0031542 | positive regulation of anthocyanin biosynthetic process |
| 3. B | GO:1904743 | negative regulation of telomeric DNA binding |
| 3. B | GO:0071347 | cellular response to interleukin-1 |
| 3. B | GO:1900383 | regulation of synaptic plasticity by receptor localization to synapse |
| 3. B | GO:0072660 | maintenance of protein location in plasma membrane |
| 3. B | GO:0090314 | positive regulation of protein targeting to membrane |
| 3. B | GO:0009967 | positive regulation of signal transduction |
| 3. B | GO:0086004 | regulation of cardiac muscle cell contraction |
| 3. B | GO:0048013 | ephrin receptor signaling pathway |
| 3. B | GO:2000134 | negative regulation of G1/S transition of mitotic cell cycle |
| 3. B | GO:1901019 | regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:0031625 | ubiquitin protein ligase binding |
| 3. B | GO:0043197 | dendritic spine |
| 3. B | GO:0045162 | clustering of voltage-gated sodium channels |
| 3. B | GO:0002009 | morphogenesis of an epithelium |
| 3. B | GO:1901187 | regulation of ephrin receptor signaling pathway |
| 3. B | GO:0008285 | negative regulation of cell population proliferation |
| 3. B | GO:0051865 | protein autoubiquitination |
| 3. B | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:0048920 | posterior lateral line neuromast primordium migration |
| 3. B | GO:0033209 | tumor necrosis factor-mediated signaling pathway |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:0008139 | nuclear localization sequence binding |
| 3. B | GO:0036309 | protein localization to M-band |
| 3. B | GO:0033268 | node of Ranvier |
| 3. B | GO:0048665 | neuron fate specification |
| 3. B | GO:0035507 | regulation of myosin-light-chain-phosphatase activity |
| 3. B | GO:0050807 | regulation of synapse organization |
| 3. B | GO:1903527 | positive regulation of membrane tubulation |
| 3. B | GO:0034394 | protein localization to cell surface |
| 3. B | GO:0008092 | cytoskeletal protein binding |
| 3. B | GO:0071709 | membrane assembly |
| 3. B | GO:0086069 | bundle of His cell to Purkinje myocyte communication |
| 3. B | GO:0045732 | positive regulation of protein catabolic process |
| 3. B | GO:0034446 | substrate adhesion-dependent cell spreading |
| 3. B | GO:0051924 | regulation of calcium ion transport |
| 3. B | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0085042 | periarbuscular membrane |
| 3. B | GO:0060992 | response to fungicide |
| 3. B | GO:0030673 | axolemma |
| 3. B | GO:0031432 | titin binding |
| 3. B | GO:0019899 | enzyme binding |
| 3. B | GO:0051928 | positive regulation of calcium ion transport |
| 3. B | GO:0034112 | positive regulation of homotypic cell-cell adhesion |
| 3. B | GO:0021508 | floor plate formation |
| 3. B | GO:0034613 | cellular protein localization |
| 3. B | GO:0051570 | regulation of histone H3-K9 methylation |
| 3. B | GO:0006471 | protein ADP-ribosylation |
| 3. B | GO:0004857 | enzyme inhibitor activity |
| 3. B | GO:0086070 | SA node cell to atrial cardiac muscle cell communication |
| 3. B | GO:0005200 | structural constituent of cytoskeleton |
| 3. B | GO:1901018 | positive regulation of potassium ion transmembrane transporter activity |
| 3. B | GO:0050714 | positive regulation of protein secretion |
| 3. B | GO:0048859 | formation of anatomical boundary |
| 3. B | GO:0042327 | positive regulation of phosphorylation |
| 3. B | GO:0031663 | lipopolysaccharide-mediated signaling pathway |
| 3. B | GO:0070972 | protein localization to endoplasmic reticulum |
| 3. B | GO:0043268 | positive regulation of potassium ion transport |
| 3. B | GO:0086066 | atrial cardiac muscle cell to AV node cell communication |
| 3. B | GO:1901021 | positive regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0031267 | small GTPase binding |
| 3. B | GO:0060035 | notochord cell development |
| 3. B | GO:0005925 | focal adhesion |
| 3. B | GO:0021654 | rhombomere boundary formation |
| 3. B | GO:0045685 | regulation of glial cell differentiation |
| 3. B | GO:0030513 | positive regulation of BMP signaling pathway |
| 3. B | GO:0033256 | I-kappaB/NF-kappaB complex |
| 3. B | GO:0032991 | protein-containing complex |
| 3. B | GO:0005829 | cytosol |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0004861 | cyclin-dependent protein serine/threonine kinase inhibitor activity |
| 3. B | GO:0042281 | dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase activity |
| 3. B | GO:0055002 | striated muscle cell development |
| 3. B | GO:0035544 | negative regulation of SNARE complex assembly |
| 3. B | GO:0035508 | positive regulation of myosin-light-chain-phosphatase activity |
| 3. B | GO:0007528 | neuromuscular junction development |
| 3. B | GO:0000062 | fatty-acyl-CoA binding |
| 3. B | GO:0002102 | podosome |
| 3. B | GO:0000139 | Golgi membrane |
| 3. B | GO:1900827 | positive regulation of membrane depolarization during cardiac muscle cell action potential |
| 3. B | GO:0035556 | intracellular signal transduction |
| 3. B | GO:0048892 | lateral line nerve development |
| 3. B | GO:0045807 | positive regulation of endocytosis |
| 3. B | GO:0098686 | hippocampal mossy fiber to CA3 synapse |
| 3. B | GO:0042326 | negative regulation of phosphorylation |
| 3. B | GO:0008093 | cytoskeletal anchor activity |
| 3. B | GO:0010667 | negative regulation of cardiac muscle cell apoptotic process |
| 3. B | GO:0048916 | posterior lateral line development |
| 3. B | GO:0005938 | cell cortex |
| 3. B | GO:0045773 | positive regulation of axon extension |
| 3. B | GO:1904357 | negative regulation of telomere maintenance via telomere lengthening |
| 3. B | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0030674 | protein-macromolecule adaptor activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8BY98 | Ankyrin repeat domain-containing protein SOWAHD | 1.48e-04 | 3.26e-05 | 4.99e-31 |
| 1. PB | A6NJG2 | Ankyrin repeat domain-containing protein SOWAHD | 7.42e-06 | 1.11e-05 | 8.36e-26 |
| 1. PB | Q8BLS7 | Ankyrin repeat domain-containing protein SOWAHA | 6.71e-05 | 3.88e-34 | 1.40e-41 |
| 1. PB | Q53LP3 | Ankyrin repeat domain-containing protein SOWAHC | 0 | 8.93e-156 | 0.0 |
| 1. PB | Q8C0J6 | Ankyrin repeat domain-containing protein SOWAHC | 9.01e-09 | 3.19e-76 | 0.0 |
| 1. PB | Q2M3V2 | Ankyrin repeat domain-containing protein SOWAHA | 6.53e-04 | 9.63e-34 | 2.11e-30 |
| 2. P | Q6F3J0 | Nuclear factor NF-kappa-B p105 subunit | 2.31e-01 | 8.29e-03 | NA |
| 2. P | Q3S405 | Transcription factor SWI6 | 7.73e-02 | 2.42e-03 | NA |
| 2. P | Q04861 | Nuclear factor NF-kappa-B p105 subunit | 2.43e-01 | 2.80e-02 | NA |
| 2. P | O73630 | Nuclear factor NF-kappa-B p100 subunit | 1.51e-01 | 1.03e-04 | NA |
| 2. P | P09959 | Regulatory protein SWI6 | 1.80e-01 | 1.89e-04 | NA |
| 2. P | P98150 | Nuclear factor NF-kappa-B p100 subunit | 2.16e-01 | 4.18e-03 | NA |
| 2. P | P39678 | Transcription factor MBP1 | 2.89e-02 | 5.77e-04 | NA |
| 2. P | P40418 | Regulatory protein SWI6 | 7.15e-02 | 2.62e-02 | NA |
| 2. P | Q9WTK5 | Nuclear factor NF-kappa-B p100 subunit | 1.19e-01 | 3.93e-02 | NA |
| 2. P | G4NID8 | Transcription factor SWI6 | 1.46e-01 | 2.42e-03 | NA |
| 2. P | Q00653 | Nuclear factor NF-kappa-B p100 subunit | 1.79e-01 | 8.97e-03 | NA |
| 2. P | P39679 | Transcription factor MBP1 | 4.15e-02 | 1.68e-05 | NA |
| 2. P | Q4KL97 | Ankyrin repeat domain-containing protein 1 | 1.04e-03 | 2.25e-03 | NA |
| 2. P | P20749 | B-cell lymphoma 3 protein | 1.25e-03 | 1.77e-02 | NA |
| 2. P | Q9GZV1 | Ankyrin repeat domain-containing protein 2 | 2.35e-02 | 3.07e-02 | NA |
| 2. P | Q03017 | NF-kappa-B inhibitor cactus | 7.34e-02 | 6.17e-06 | NA |
| 2. P | P83757 | NF-kappa-B inhibitor cactus | NA | 2.42e-06 | NA |
| 2. P | P41412 | Cell division cycle-related protein res2/pct1 | 1.02e-01 | 4.35e-02 | NA |
| 2. P | P01129 | Start control protein cdc10 | 4.45e-02 | 4.04e-02 | NA |
| 3. B | A2VDR2 | Acyl-CoA-binding domain-containing protein 6 | 5.85e-03 | NA | 0.001 |
| 3. B | Q9BGT9 | Ankyrin repeat and SOCS box protein 7 | 1.11e-04 | NA | 5.88e-05 |
| 3. B | Q8N9V6 | Ankyrin repeat domain-containing protein 53 | 7.03e-03 | NA | 0.002 |
| 3. B | Q00PJ1 | Cortactin-binding protein 2 | 3.52e-01 | NA | 0.002 |
| 3. B | Q8BX02 | KN motif and ankyrin repeat domain-containing protein 2 | 2.87e-01 | NA | 0.011 |
| 3. B | Q07DZ5 | Cortactin-binding protein 2 | 1.66e-01 | NA | 0.004 |
| 3. B | Q2TXF6 | Ankyrin repeat domain-containing protein oryK | 2.35e-01 | NA | 0.017 |
| 3. B | Q15327 | Ankyrin repeat domain-containing protein 1 | 9.85e-03 | NA | 0.021 |
| 3. B | Q80SY4 | E3 ubiquitin-protein ligase MIB1 | 1.66e-01 | NA | 5.85e-06 |
| 3. B | Q54KA7 | Ankyrin repeat, PH and SEC7 domain containing protein secG | 8.36e-02 | NA | 0.002 |
| 3. B | Q810N6 | Ankyrin repeat domain-containing protein 45 | 1.35e-02 | NA | 4.29e-04 |
| 3. B | Q02989 | Alpha-latroinsectotoxin-Lt1a (Fragment) | 1.74e-01 | NA | 0.004 |
| 3. B | P16157 | Ankyrin-1 | 5.17e-01 | NA | 4.99e-04 |
| 3. B | O14974 | Protein phosphatase 1 regulatory subunit 12A | 7.29e-02 | NA | 0.019 |
| 3. B | Q337A0 | Probable E3 ubiquitin-protein ligase XBOS33 | 1.81e-02 | NA | 0.006 |
| 3. B | D3ZD05 | KN motif and ankyrin repeat domain-containing protein 2 | 3.48e-02 | NA | 0.004 |
| 3. B | Q86YT6 | E3 ubiquitin-protein ligase MIB1 | 1.99e-01 | NA | 7.13e-06 |
| 3. B | P57078 | Receptor-interacting serine/threonine-protein kinase 4 | 4.69e-02 | NA | 0.001 |
| 3. B | O95271 | Poly [ADP-ribose] polymerase tankyrase-1 | 8.92e-02 | NA | 0.030 |
| 3. B | Q9TZC4 | Integrin-linked protein kinase homolog pat-4 | 3.51e-03 | NA | 0.036 |
| 3. B | O89019 | Inversin | 2.19e-01 | NA | 0.002 |
| 3. B | Q9Y575 | Ankyrin repeat and SOCS box protein 3 | 9.87e-04 | NA | 0.023 |
| 3. B | Q53RE8 | Ankyrin repeat domain-containing protein 39 | 1.24e-03 | NA | 8.77e-04 |
| 3. B | G0LXV8 | Alpha-latrotoxin-Lh1a (Fragment) | 3.01e-01 | NA | 0.002 |
| 3. B | Q9EP71 | Ankycorbin | 3.40e-02 | NA | 0.004 |
| 3. B | Q4FE45 | E3 ubiquitin-protein ligase XBAT33 | 2.15e-02 | NA | 0.007 |
| 3. B | Q2QLB3 | Cortactin-binding protein 2 | 7.48e-01 | NA | 4.97e-05 |
| 3. B | D3J162 | Protein VAPYRIN | 2.25e-01 | NA | 1.34e-04 |
| 3. B | Q69ZU8 | Ankyrin repeat domain-containing protein 6 | 1.91e-02 | NA | 0.001 |
| 3. B | Q0P5B9 | Ankyrin repeat domain-containing protein 39 | 5.98e-04 | NA | 0.002 |
| 3. B | Q6PFX9 | Poly [ADP-ribose] polymerase tankyrase-1 | 1.16e-01 | NA | 0.032 |
| 3. B | O55222 | Integrin-linked protein kinase | 1.24e-02 | NA | 2.75e-04 |
| 3. B | Q2IBB2 | Cortactin-binding protein 2 | 3.11e-01 | NA | 0.005 |
| 3. B | Q8MJ49 | Osteoclast-stimulating factor 1 | 6.65e-04 | NA | 0.040 |
| 3. B | Q5ZLC6 | Ankyrin repeat domain-containing protein 10 | 2.92e-03 | NA | 0.017 |
| 3. B | C7B178 | Protein VAPYRIN | 2.14e-01 | NA | 2.80e-05 |
| 3. B | Q07E41 | Cortactin-binding protein 2 | 4.13e-01 | NA | 0.001 |
| 3. B | Q4V8X4 | Acyl-CoA-binding domain-containing protein 6 | 1.32e-02 | NA | 0.004 |
| 3. B | Q2QLG9 | Cortactin-binding protein 2 | 1.41e-01 | NA | 2.02e-05 |
| 3. B | Q09YI1 | Cortactin-binding protein 2 | 3.02e-01 | NA | 5.13e-04 |
| 3. B | Q8VHK2 | Caskin-1 | 2.80e-01 | NA | 0.001 |
| 3. B | O15084 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 7.72e-02 | NA | 3.84e-04 |
| 3. B | Q60772 | Cyclin-dependent kinase 4 inhibitor C | 5.46e-05 | NA | 0.037 |
| 3. B | Q96AX9 | E3 ubiquitin-protein ligase MIB2 | 2.25e-01 | NA | 2.75e-05 |
| 3. B | Q02357 | Ankyrin-1 | 3.58e-01 | NA | 5.86e-04 |
| 3. B | O44997 | Death-associated protein kinase dapk-1 | 3.72e-01 | NA | 7.04e-04 |
| 3. B | Q8BTI7 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 2.21e-01 | NA | 0.011 |
| 3. B | Q6NRL1 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 | 3.48e-01 | NA | 0.015 |
| 3. B | Q6ZVH7 | Espin-like protein | 2.69e-02 | NA | 0.006 |
| 3. B | Q5U312 | Ankycorbin | 4.51e-02 | NA | 0.012 |
| 3. B | Q65XV2 | E3 ubiquitin-protein ligase XB3 | 5.12e-02 | NA | 0.026 |
| 3. B | Q9H9B1 | Histone-lysine N-methyltransferase EHMT1 | 1.13e-01 | NA | 8.97e-05 |
| 3. B | Q99ME3 | Synphilin-1 | 2.43e-01 | NA | 5.51e-05 |
| 3. B | Q07E28 | Cortactin-binding protein 2 | 4.04e-01 | NA | 1.47e-05 |
| 3. B | P42773 | Cyclin-dependent kinase 4 inhibitor C | 1.45e-05 | NA | 0.002 |
| 3. B | B4E2M5 | Ankyrin repeat domain-containing protein 66 | 2.25e-03 | NA | 0.013 |
| 3. B | Q28BK1 | E3 ubiquitin-protein ligase HACE1 | 1.58e-01 | NA | 0.002 |
| 3. B | Q08353 | NF-kappa-B inhibitor alpha | 1.05e-02 | NA | 0.006 |
| 3. B | Q4JHE0 | Probable E3 ubiquitin-protein ligase XBOS36 | 1.52e-02 | NA | 7.58e-05 |
| 3. B | G5E8K5 | Ankyrin-3 | 4.43e-01 | NA | 2.51e-04 |
| 3. B | Q9VUX2 | E3 ubiquitin-protein ligase mind-bomb | 3.41e-01 | NA | 3.77e-05 |
| 3. B | Q5GIG6 | Serine/threonine-protein kinase TNNI3K | 2.69e-02 | NA | 0.008 |
| 3. B | Q92625 | Ankyrin repeat and SAM domain-containing protein 1A | 1.12e-01 | NA | 0.024 |
| 3. B | A0M8T5 | Cortactin-binding protein 2 | 3.14e-01 | NA | 1.52e-05 |
| 3. B | Q6DD51 | Caskin-2 | 5.30e-01 | NA | 1.76e-04 |
| 3. B | Q07E15 | Cortactin-binding protein 2 | 4.17e-01 | NA | 4.68e-05 |
| 3. B | Q9ERK0 | Receptor-interacting serine/threonine-protein kinase 4 | 6.36e-02 | NA | 5.56e-04 |
| 3. B | O70511 | Ankyrin-3 | 8.14e-01 | NA | 1.47e-04 |
| 3. B | Q90623 | Protein phosphatase 1 regulatory subunit 12A | 5.63e-01 | NA | 0.013 |
| 3. B | Q09YJ3 | Cortactin-binding protein 2 | 3.22e-01 | NA | 5.13e-04 |
| 3. B | Q12955 | Ankyrin-3 | NA | NA | 6.30e-05 |
| 3. B | Q3U0D9 | E3 ubiquitin-protein ligase HACE1 | 1.30e-01 | NA | 0.003 |
| 3. B | Q5TZF3 | Ankyrin repeat domain-containing protein 45 | 1.51e-02 | NA | 0.003 |
| 3. B | Q7EZ44 | Probable E3 ubiquitin-protein ligase XBOS35 | 4.89e-02 | NA | 1.23e-04 |
| 3. B | Q9Z2X3 | 26S proteasome non-ATPase regulatory subunit 10 | 2.09e-05 | NA | 0.021 |
| 3. B | Q63746 | NF-kappa-B inhibitor alpha | 1.14e-02 | NA | 0.005 |
| 3. B | Q6XJU9 | Osteoclast-stimulating factor 1 | 8.17e-04 | NA | 0.014 |
| 3. B | Q10728 | Protein phosphatase 1 regulatory subunit 12A | 7.14e-02 | NA | 0.018 |
| 3. B | Q3V0J4 | Ankyrin repeat domain-containing protein 53 | 5.83e-02 | NA | 0.001 |
| 3. B | Q7Z6G8 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 1.26e-01 | NA | 0.024 |
| 3. B | Q07DV1 | Cortactin-binding protein 2 | 3.29e-01 | NA | 0.043 |
| 3. B | Q5R5V4 | Integrin-linked protein kinase | 6.24e-03 | NA | 2.50e-04 |
| 3. B | O75762 | Transient receptor potential cation channel subfamily A member 1 | 2.25e-01 | NA | 0.010 |
| 3. B | Q10311 | Ankyrin repeat-containing protein C6C3.08 | 5.18e-07 | NA | 0.036 |
| 3. B | Q9FNP4 | Phytochrome-interacting ankyrin-repeat protein 2 | 7.85e-06 | NA | 0.040 |
| 3. B | Q04749 | Target of rapamycin complex 2 subunit AVO2 | 2.07e-03 | NA | 1.96e-05 |
| 3. B | Q07DW4 | Cortactin-binding protein 2 | 1.69e-01 | NA | 2.42e-04 |
| 3. B | A2A690 | Protein TANC2 | 7.29e-01 | NA | 0.019 |
| 3. B | Q6KAE5 | Probable E3 ubiquitin-protein ligase XBOS32 | 1.80e-02 | NA | 5.76e-05 |
| 3. B | Q9QWY8 | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 | 4.95e-01 | NA | 0.005 |
| 3. B | Q9TZM3 | Leucine-rich repeat serine/threonine-protein kinase 1 | 3.77e-01 | NA | 3.06e-05 |
| 3. B | Q6NY19 | KN motif and ankyrin repeat domain-containing protein 3 | 8.83e-02 | NA | 2.64e-04 |
| 3. B | Q63ZY3 | KN motif and ankyrin repeat domain-containing protein 2 | 1.47e-01 | NA | 0.007 |
| 3. B | Q07DX4 | Cortactin-binding protein 2 | 5.07e-01 | NA | 0.014 |
| 3. B | Q9CR42 | Ankyrin repeat domain-containing protein 1 | 4.99e-02 | NA | 0.012 |
| 3. B | A0M8S4 | Cortactin-binding protein 2 | 2.71e-01 | NA | 4.15e-05 |
| 3. B | Q9Z1E3 | NF-kappa-B inhibitor alpha | 3.53e-03 | NA | 0.002 |
| 3. B | Q09YK4 | Cortactin-binding protein 2 | 3.87e-01 | NA | 2.06e-04 |
| 3. B | Q8C8R3 | Ankyrin-2 | NA | NA | 1.63e-04 |
| 3. B | E1C656 | E3 ubiquitin-protein ligase HACE1 | 7.29e-02 | NA | 0.001 |
| 3. B | Q9TU71 | Ankyrin repeat domain-containing protein 1 | 6.29e-03 | NA | 0.008 |
| 3. B | Q96NW4 | Ankyrin repeat domain-containing protein 27 | 1.40e-01 | NA | 0.012 |
| 3. B | Q8BZW2 | Ankyrin repeat domain-containing protein SOWAHB | 1.10e-02 | NA | 1.49e-28 |
| 3. B | Q2QLA2 | Cortactin-binding protein 2 | 1.28e-01 | NA | 0.011 |
| 3. B | Q9D2X0 | Ankyrin repeat domain-containing protein 39 | 1.14e-03 | NA | 0.002 |
| 3. B | Q8BIZ1 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 4.06e-01 | NA | 0.016 |
| 3. B | Q6AWW5 | Ankyrin repeat-containing protein At5g02620 | 3.12e-02 | NA | 0.036 |
| 3. B | Q6P9K8 | Caskin-1 | 4.09e-01 | NA | 0.001 |
| 3. B | A6NEL2 | Ankyrin repeat domain-containing protein SOWAHB | 4.04e-03 | NA | 1.08e-28 |
| 3. B | Q8WXE0 | Caskin-2 | 2.69e-01 | NA | 2.28e-05 |
| 3. B | Q2IBA2 | Cortactin-binding protein 2 | 1.29e-01 | NA | 4.15e-05 |
| 3. B | Q9D061 | Acyl-CoA-binding domain-containing protein 6 | 6.59e-03 | NA | 0.008 |
| 3. B | A3AYR1 | Acyl-CoA-binding domain-containing protein 4 | 3.51e-02 | NA | 0.030 |
| 3. B | Q5DW34 | Histone-lysine N-methyltransferase EHMT1 | 1.27e-01 | NA | 1.99e-04 |
| 3. B | Q07DY4 | Cortactin-binding protein 2 | 2.98e-01 | NA | 4.41e-05 |
| 3. B | Q3SWY2 | Integrin-linked protein kinase | 4.05e-03 | NA | 2.43e-04 |
| 3. B | Q80YE7 | Death-associated protein kinase 1 | 3.78e-01 | NA | 0.001 |
| 3. B | Q06547 | GA-binding protein subunit beta-1 | 2.19e-02 | NA | 0.042 |
| 3. B | A1X157 | Cortactin-binding protein 2 | 2.18e-01 | NA | 2.38e-05 |
| 3. B | Q9HCD6 | Protein TANC2 | 5.23e-01 | NA | 0.015 |
| 3. B | Q9Z148 | Histone-lysine N-methyltransferase EHMT2 | 4.40e-01 | NA | 1.32e-05 |
| 3. B | P0DJE3 | Alpha-latrotoxin-Lhe1a | 2.44e-01 | NA | 3.17e-04 |
| 3. B | Q5RCK5 | Ankyrin repeat and SOCS box protein 7 | 2.79e-03 | NA | 4.50e-05 |
| 3. B | Q96KQ7 | Histone-lysine N-methyltransferase EHMT2 | 2.21e-01 | NA | 8.30e-06 |
| 3. B | Q99J82 | Integrin-linked protein kinase | 4.10e-03 | NA | 2.75e-04 |
| 3. B | Q2IBF7 | Cortactin-binding protein 2 | 3.24e-01 | NA | 0.006 |
| 3. B | Q8UVC1 | Inversin | 8.27e-02 | NA | 0.016 |
| 3. B | Q2QLF8 | Cortactin-binding protein 2 | 3.52e-01 | NA | 0.039 |
| 3. B | Q9HFE7 | Ankyrin repeat-containing protein P16F5.05c | 9.48e-07 | NA | 0.002 |
| 3. B | Q2IBD4 | Cortactin-binding protein 2 | 2.93e-01 | NA | 0.007 |
| 3. B | Q92882 | Osteoclast-stimulating factor 1 | 7.27e-04 | NA | 0.024 |
| 3. B | Q6GNY1 | E3 ubiquitin-protein ligase mib1 | 2.61e-01 | NA | 1.45e-05 |
| 3. B | Q91ZU0 | Ankyrin repeat and SOCS box protein 7 | 1.87e-03 | NA | 6.04e-05 |
| 3. B | Q1AAU6 | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 | 4.82e-01 | NA | 0.005 |
| 3. B | Q3UYR4 | Espin-like protein | 3.83e-02 | NA | 0.002 |
| 3. B | Q4UMH6 | Putative ankyrin repeat protein RF_0381 | 4.60e-01 | NA | 0.027 |
| 3. B | Q804S5 | E3 ubiquitin-protein ligase mib1 | 2.77e-01 | NA | 7.05e-06 |
| 3. B | B9EJA2 | Cortactin-binding protein 2 | 3.91e-01 | NA | 8.43e-04 |
| 3. B | Q8IYU2 | E3 ubiquitin-protein ligase HACE1 | 1.29e-01 | NA | 0.004 |
| 3. B | X1WE18 | KN motif and ankyrin repeat domain-containing protein 2 | 1.00e-01 | NA | 0.034 |
| 3. B | Q13625 | Apoptosis-stimulating of p53 protein 2 | 3.38e-01 | NA | 1.35e-04 |
| 3. B | Q9HLN1 | Putative ankyrin repeat protein Ta0196 | 1.35e-03 | NA | 0.027 |
| 3. B | Q9Y2G4 | Ankyrin repeat domain-containing protein 6 | 1.74e-02 | NA | 0.014 |
| 3. B | Q91974 | NF-kappa-B inhibitor alpha | 1.00e-02 | NA | 0.008 |
| 3. B | Q2IBF8 | Cortactin-binding protein 2 | 3.30e-01 | NA | 0.007 |
| 3. B | Q8NB46 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 1.35e-01 | NA | 0.012 |
| 3. B | Q9ULJ7 | Ankyrin repeat domain-containing protein 50 | 1.22e-01 | NA | 0.047 |
| 3. B | P25963 | NF-kappa-B inhibitor alpha | 7.32e-03 | NA | 0.005 |
| 3. B | P0C927 | Ankyrin repeat and SOCS box protein 14 | 7.28e-02 | NA | 0.004 |
| 3. B | Q9H672 | Ankyrin repeat and SOCS box protein 7 | 1.01e-04 | NA | 5.57e-05 |
| 3. B | Q108T9 | Cortactin-binding protein 2 | 3.00e-01 | NA | 0.005 |
| 3. B | F1LTE0 | Protein TANC2 | 6.82e-01 | NA | 0.018 |
| 3. B | Q8CG79 | Apoptosis-stimulating of p53 protein 2 | 8.68e-02 | NA | 1.35e-04 |
| 3. B | Q5ZIJ9 | E3 ubiquitin-protein ligase MIB2 | 1.44e-01 | NA | 1.93e-04 |
| 3. B | Q05921 | 2-5A-dependent ribonuclease | 3.33e-02 | NA | 5.01e-04 |
| 3. B | Q8UVC3 | Inversin | 4.11e-01 | NA | 5.65e-04 |
| 3. B | Q8BZ25 | Ankyrin repeat and protein kinase domain-containing protein 1 | 2.97e-01 | NA | 8.64e-04 |
| 3. B | Q8VHK1 | Caskin-2 | 4.26e-01 | NA | 1.91e-05 |
| 3. B | Q6JAN1 | Inversin | 2.07e-01 | NA | 3.89e-04 |
| 3. B | Q5RJK8 | Acyl-CoA-binding domain-containing protein 6 | 8.61e-03 | NA | 0.027 |
| 3. B | O97902 | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 | 4.75e-01 | NA | 0.041 |
| 3. B | D3ZBM7 | E3 ubiquitin-protein ligase HACE1 | 1.21e-01 | NA | 0.004 |
| 3. B | Q2IBE6 | Cortactin-binding protein 2 | 1.16e-01 | NA | 0.011 |
| 3. B | Q05823 | 2-5A-dependent ribonuclease | 2.49e-02 | NA | 0.032 |
| 3. B | Q80VM7 | Ankyrin repeat domain-containing protein 24 | 1.00e-01 | NA | 0.006 |
| 3. B | P57044 | Integrin-linked protein kinase | 3.62e-03 | NA | 2.65e-04 |
| 3. B | Q09YG9 | Cortactin-binding protein 2 | 2.19e-01 | NA | 0.042 |
| 3. B | P23631 | Alpha-latrotoxin-Lt1a | 3.29e-01 | NA | 0.001 |
| 3. B | Q14678 | KN motif and ankyrin repeat domain-containing protein 1 | 9.70e-02 | NA | 0.011 |
| 3. B | Q52T38 | Protein S-acyltransferase 24 | 3.07e-02 | NA | 0.020 |
| 3. B | Q8WXD9 | Caskin-1 | 4.98e-01 | NA | 0.002 |
| 3. B | Q8R560 | Ankyrin repeat domain-containing protein 1 | 1.45e-02 | NA | 0.016 |
| 3. B | P46683 | Ankyrin repeat-containing protein YAR1 | 1.27e-05 | NA | 1.52e-04 |
| 3. B | P0C6S7 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 5.95e-01 | NA | 0.007 |
| 3. B | Q5ZLC8 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 3.19e-01 | NA | 0.014 |
| 3. B | Q505D1 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 1.33e-01 | NA | 3.77e-04 |
| 3. B | Q68LP1 | E3 ubiquitin-protein ligase MIB2 | 4.03e-02 | NA | 5.65e-06 |
| 3. B | Q01484 | Ankyrin-2 | NA | NA | 2.07e-04 |
| 3. B | F1N6G5 | E3 ubiquitin-protein ligase HACE1 | 3.40e-01 | NA | 0.004 |
| 3. B | Q8WZ74 | Cortactin-binding protein 2 | 2.81e-01 | NA | 0.005 |
| 3. B | Q54GC8 | Acyl-CoA-binding domain-containing protein 6 homolog | 5.19e-05 | NA | 0.002 |
| 3. B | Q9DF58 | Integrin-linked protein kinase | 3.39e-03 | NA | 2.61e-04 |
| 3. B | Q865U8 | Ankyrin repeat domain-containing protein 1 | 8.33e-03 | NA | 0.020 |
| 3. B | Q8NFD2 | Ankyrin repeat and protein kinase domain-containing protein 1 | 1.33e-01 | NA | 0.020 |
| 3. B | F8W2M1 | E3 ubiquitin-protein ligase HACE1 | 3.33e-02 | NA | 0.001 |
| 3. B | Q6NLQ8 | E3 ubiquitin-protein ligase XBAT32 | 1.83e-02 | NA | 0.002 |
| 3. B | Q6NRK3 | Ankyrin repeat domain-containing protein SOWAHB | 4.71e-03 | NA | 5.73e-28 |
| 3. B | Q6DRG7 | Protein phosphatase 1 regulatory subunit 12A | 5.40e-01 | NA | 0.014 |
| 3. B | Q9DBR7 | Protein phosphatase 1 regulatory subunit 12A | 8.72e-02 | NA | 0.020 |
| 3. B | Q7Z3H0 | Photoreceptor ankyrin repeat protein | 3.75e-02 | NA | 0.004 |
| 3. B | Q9Y283 | Inversin | 5.58e-02 | NA | 0.001 |
| 3. B | Q9Y6H5 | Synphilin-1 | 1.61e-02 | NA | 3.83e-05 |
| 3. B | Q8R516 | E3 ubiquitin-protein ligase MIB2 | 4.84e-02 | NA | 5.37e-06 |
| 3. B | Q6DCL5 | E3 ubiquitin-protein ligase HACE1 | 1.13e-01 | NA | 0.002 |
| 3. B | Q2QL82 | Cortactin-binding protein 2 | 2.24e-01 | NA | 6.36e-04 |
| 3. B | Q13418 | Integrin-linked protein kinase | 4.08e-03 | NA | 2.61e-04 |
| 3. B | Q1LZH7 | KN motif and ankyrin repeat domain-containing protein 2 | 3.45e-02 | NA | 0.002 |
| 3. B | Q9BR61 | Acyl-CoA-binding domain-containing protein 6 | 3.65e-03 | NA | 0.032 |
| 3. B | Q9FF09 | Phytochrome-interacting ankyrin-repeat protein 1 | 5.74e-04 | NA | 0.011 |