Results | PROST

Summary

Q53LP3

Homolog: Q8C0J6.
Function: Ankyrin repeat domain-containing protein SOWAHC.

Statistics

Total GO Annotation: 446
Unique PROST Go: 67
Unique BLAST Go: 369

Total Homologs: 224
Unique PROST Homologs: 19
Unique BLAST Homologs: 199

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8C0J6 (Ankyrin repeat domain-containing protein SOWAHC) with a FATCAT P-Value: 9.01e-09 and RMSD of 5.96 angstrom. The sequence alignment identity is 70.3%.
Structural alignment shown in left. Query protein Q53LP3 colored as red in alignment, homolog Q8C0J6 colored as blue. Query protein Q53LP3 is also shown in right top, homolog Q8C0J6 showed in right bottom. They are colored based on secondary structures.

  Q53LP3 MEGPAEWGPEAALGPEAVLRFLAERGGRALHAELVQHFRGALGGEPEQRARARAHFKELVNAVATVRVDPADGAKYVHLKKRFCEGPSEP-----SGDPP 95
  Q8C0J6 MEGSLE------LSSEAILRFLAERGGRAGHSELVQHFRDVLGGQREQRTRARERFKELVNAVATVRTDPADGTKYVHLKKRFCTGDSPPLEAKLPREPP 94

  Q53LP3 RIQVTAEPEAPDGPAGPEARDRLPDAAAPE-SLPGQGRELGEGEPPAPAHWPPLSAGARRKNS-RRDVQPLPRTPAPGPSEDLELPPHGCEEADRGSSLV 193
  Q8C0J6 RIEVTEEPQVPDLAAEPCEGSQLQE-ANPQLSL-GLGGEVSDQEPPAPA-----QGGAQGKDSPPQEVEAVSWASGPGSSENLKLPPQG--EAEGGSSPS 185

  Q53LP3 GATAQRPARQNLRDLVMGSSPQLKRSVCPGGSSPGSSSGGGRGRGGGDSDSASVASSSAEEESSGGGSVTLDPLEHAWMLSASDGKWDSLEGLLTCEPGL 293
  Q8C0J6 GPNTPRSARQNFRDLVLGSSPQLKRSV--G---PGDGNAGGRSRGGGDSDTASLASSSAEEESSVGASVTLDPLDHAWMLSASEGKWDSLEGLLTCEPGL 280

  Q53LP3 LVKRDFITGFTCLHWAAKHGRQELLAMLVNFANKHQLPVNIDARTSGGYTALHLAAMHGHVEVVKLLVGAYDADVDIRDYSGKKASQYLSRSIAEEIKNL 393
  Q8C0J6 LSKRDFITGFTCLHWAAKHGRQELLAMLVNFATKHQLPVNINAKSSGGYTALHLAAMHGHVEVVKLLVGAYDADVDIRDYSGRKASQYLSESIAEEIKNL 380

  Q53LP3 VGALDEGDGESAAGSGGGRWRLSKVLPSHLITYKLSHALEDGGDHHHHHHSAEGWVGG-KAKDPGRKASGSSSGRIKPRLNKIRFRTQIVHTTPSFRDPE 492
  Q8C0J6 VGALDEDDGDSPAARGGGRWRLSKVLPSH-ITHKLSPVVEDGAE--LHHHVPEGWTGGSKAKDSGRKASGSSSGRMKPRLNKIRFRTQIIHTTPSFRD-A 476

  Q53LP3 QP-L-EGRGEEGVGEERPVKGH-SPFTLRPKSNVFG 525
  Q8C0J6 KPTLEEGEEEEEEEEERSLRGYSSSFKLRPKSNVFG 512

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0051059	NF-kappaB binding
1. PB	GO:0045944	positive regulation of transcription by RNA polymerase II
1. PB	GO:0030907	MBF transcription complex
1. PB	GO:0007249	I-kappaB kinase/NF-kappaB signaling
1. PB	GO:0033309	SBF transcription complex
1. PB	GO:0000122	negative regulation of transcription by RNA polymerase II
1. PB	GO:0007253	cytoplasmic sequestering of NF-kappaB
1. PB	GO:0035994	response to muscle stretch
1. PB	GO:0007165	signal transduction
1. PB	GO:0031674	I band
2. P	GO:0030198	extracellular matrix organization
2. P	GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific
2. P	GO:0002455	humoral immune response mediated by circulating immunoglobulin
2. P	GO:1901222	regulation of NIK/NF-kappaB signaling
2. P	GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
2. P	GO:0045662	negative regulation of myoblast differentiation
2. P	GO:0032496	response to lipopolysaccharide
2. P	GO:0032717	negative regulation of interleukin-8 production
2. P	GO:0032720	negative regulation of tumor necrosis factor production
2. P	GO:1900127	positive regulation of hyaluronan biosynthetic process
2. P	GO:0071359	cellular response to dsRNA
2. P	GO:0043619	regulation of transcription from RNA polymerase II promoter in response to oxidative stress
2. P	GO:0071212	subsynaptic reticulum
2. P	GO:0003713	transcription coactivator activity
2. P	GO:0007399	nervous system development
2. P	GO:0048511	rhythmic process
2. P	GO:0008307	structural constituent of muscle
2. P	GO:0071931	positive regulation of transcription involved in G1/S transition of mitotic cell cycle
2. P	GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific
2. P	GO:0042088	T-helper 1 type immune response
2. P	GO:0046843	dorsal appendage formation
2. P	GO:0032733	positive regulation of interleukin-10 production
2. P	GO:0000791	euchromatin
2. P	GO:0045751	negative regulation of Toll signaling pathway
2. P	GO:0005634	nucleus
2. P	GO:2000630	positive regulation of miRNA metabolic process
2. P	GO:0030435	sporulation resulting in formation of a cellular spore
2. P	GO:0002789	negative regulation of antifungal peptide production
2. P	GO:0042805	actinin binding
2. P	GO:0043422	protein kinase B binding
2. P	GO:0002467	germinal center formation
2. P	GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT
2. P	GO:0000785	chromatin
2. P	GO:0051101	regulation of DNA binding
2. P	GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle
2. P	GO:0045611	negative regulation of hemocyte differentiation
2. P	GO:0031594	neuromuscular junction
2. P	GO:0033257	Bcl3/NF-kappaB2 complex
2. P	GO:0006357	regulation of transcription by RNA polymerase II
2. P	GO:0032695	negative regulation of interleukin-12 production
2. P	GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
2. P	GO:1904385	cellular response to angiotensin
2. P	GO:1990837	sequence-specific double-stranded DNA binding
2. P	GO:0061408	positive regulation of transcription from RNA polymerase II promoter in response to heat stress
2. P	GO:0071316	cellular response to nicotine
2. P	GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
2. P	GO:0002315	marginal zone B cell differentiation
2. P	GO:0010225	response to UV-C
2. P	GO:0009950	dorsal/ventral axis specification
2. P	GO:0010956	negative regulation of calcidiol 1-monooxygenase activity
2. P	GO:0048536	spleen development
2. P	GO:0048315	conidium formation
2. P	GO:0030330	DNA damage response, signal transduction by p53 class mediator
2. P	GO:0048535	lymph node development
2. P	GO:0034097	response to cytokine
2. P	GO:0002268	follicular dendritic cell differentiation
2. P	GO:0042832	defense response to protozoan
2. P	GO:0045064	T-helper 2 cell differentiation
2. P	GO:0051445	regulation of meiotic cell cycle
2. P	GO:0007568	aging
2. P	GO:0071354	cellular response to interleukin-6
2. P	GO:0045893	positive regulation of transcription, DNA-templated
2. P	GO:0038061	NIK/NF-kappaB signaling
2. P	GO:0032996	Bcl3-Bcl10 complex
2. P	GO:0019730	antimicrobial humoral response
2. P	GO:0009303	rRNA transcription
2. P	GO:0010845	positive regulation of reciprocal meiotic recombination
3. B	GO:1903356	positive regulation of distal tip cell migration
3. B	GO:0071286	cellular response to magnesium ion
3. B	GO:0043198	dendritic shaft
3. B	GO:0030837	negative regulation of actin filament polymerization
3. B	GO:0042994	cytoplasmic sequestering of transcription factor
3. B	GO:0050775	positive regulation of dendrite morphogenesis
3. B	GO:0050729	positive regulation of inflammatory response
3. B	GO:0048709	oligodendrocyte differentiation
3. B	GO:0043034	costamere
3. B	GO:0006511	ubiquitin-dependent protein catabolic process
3. B	GO:0001701	in utero embryonic development
3. B	GO:0016567	protein ubiquitination
3. B	GO:0036166	phenotypic switching
3. B	GO:0070563	negative regulation of vitamin D receptor signaling pathway
3. B	GO:0030334	regulation of cell migration
3. B	GO:0001756	somitogenesis
3. B	GO:0039022	pronephric duct development
3. B	GO:2001259	positive regulation of cation channel activity
3. B	GO:0021514	ventral spinal cord interneuron differentiation
3. B	GO:0006468	protein phosphorylation
3. B	GO:0045663	positive regulation of myoblast differentiation
3. B	GO:0018105	peptidyl-serine phosphorylation
3. B	GO:0014044	Schwann cell development
3. B	GO:0006306	DNA methylation
3. B	GO:0106310	protein serine kinase activity
3. B	GO:0046974	histone methyltransferase activity (H3-K9 specific)
3. B	GO:0018024	histone-lysine N-methyltransferase activity
3. B	GO:0042127	regulation of cell population proliferation
3. B	GO:0004842	ubiquitin-protein transferase activity
3. B	GO:0008021	synaptic vesicle
3. B	GO:0030018	Z disc
3. B	GO:0048259	regulation of receptor-mediated endocytosis
3. B	GO:0097431	mitotic spindle pole
3. B	GO:0003950	NAD+ ADP-ribosyltransferase activity
3. B	GO:0032956	regulation of actin cytoskeleton organization
3. B	GO:0036372	opsin transport
3. B	GO:0021519	spinal cord association neuron specification
3. B	GO:0021536	diencephalon development
3. B	GO:0036377	arbuscular mycorrhizal association
3. B	GO:0045669	positive regulation of osteoblast differentiation
3. B	GO:0099612	protein localization to axon
3. B	GO:0005524	ATP binding
3. B	GO:0071803	positive regulation of podosome assembly
3. B	GO:0034968	histone lysine methylation
3. B	GO:0016571	histone methylation
3. B	GO:0030054	cell junction
3. B	GO:0071260	cellular response to mechanical stimulus
3. B	GO:0010765	positive regulation of sodium ion transport
3. B	GO:0035304	regulation of protein dephosphorylation
3. B	GO:0018027	peptidyl-lysine dimethylation
3. B	GO:0061551	trigeminal ganglion development
3. B	GO:0035690
3. B	GO:0010960	magnesium ion homeostasis
3. B	GO:0001650	fibrillar center
3. B	GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding
3. B	GO:0072659	protein localization to plasma membrane
3. B	GO:0086015	SA node cell action potential
3. B	GO:1990404	protein ADP-ribosylase activity
3. B	GO:0016328	lateral plasma membrane
3. B	GO:0036464	cytoplasmic ribonucleoprotein granule
3. B	GO:0003151	outflow tract morphogenesis
3. B	GO:0021675	nerve development
3. B	GO:0002039	p53 binding
3. B	GO:0000281	mitotic cytokinesis
3. B	GO:0001841	neural tube formation
3. B	GO:0080173	male-female gamete recognition during double fertilization forming a zygote and endosperm
3. B	GO:0048899	anterior lateral line development
3. B	GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway
3. B	GO:0001222	transcription corepressor binding
3. B	GO:0007009	plasma membrane organization
3. B	GO:2000393	negative regulation of lamellipodium morphogenesis
3. B	GO:0043292	contractile fiber
3. B	GO:0043517	positive regulation of DNA damage response, signal transduction by p53 class mediator
3. B	GO:0019843	rRNA binding
3. B	GO:0010564	regulation of cell cycle process
3. B	GO:0048145	regulation of fibroblast proliferation
3. B	GO:0070212	protein poly-ADP-ribosylation
3. B	GO:0042417	dopamine metabolic process
3. B	GO:0034142	toll-like receptor 4 signaling pathway
3. B	GO:0018026	peptidyl-lysine monomethylation
3. B	GO:0007160	cell-matrix adhesion
3. B	GO:0032426	stereocilium tip
3. B	GO:0000151	ubiquitin ligase complex
3. B	GO:0019228	neuronal action potential
3. B	GO:1900119	positive regulation of execution phase of apoptosis
3. B	GO:0005654	nucleoplasm
3. B	GO:0021555	midbrain-hindbrain boundary morphogenesis
3. B	GO:0086046	membrane depolarization during SA node cell action potential
3. B	GO:0072073	kidney epithelium development
3. B	GO:0051569	regulation of histone H3-K4 methylation
3. B	GO:0005819	spindle
3. B	GO:0035023	regulation of Rho protein signal transduction
3. B	GO:0072357	PTW/PP1 phosphatase complex
3. B	GO:0009925	basal plasma membrane
3. B	GO:0009932	cell tip growth
3. B	GO:0043086	negative regulation of catalytic activity
3. B	GO:0022011	myelination in peripheral nervous system
3. B	GO:0005764	lysosome
3. B	GO:0010650	positive regulation of cell communication by electrical coupling
3. B	GO:0010313	phytochrome binding
3. B	GO:0045638	negative regulation of myeloid cell differentiation
3. B	GO:0000209	protein polyubiquitination
3. B	GO:0001947	heart looping
3. B	GO:0002027	regulation of heart rate
3. B	GO:0010638	positive regulation of organelle organization
3. B	GO:0061000	negative regulation of dendritic spine development
3. B	GO:0005178	integrin binding
3. B	GO:2000178	negative regulation of neural precursor cell proliferation
3. B	GO:0060998	regulation of dendritic spine development
3. B	GO:0044325	transmembrane transporter binding
3. B	GO:0008593	regulation of Notch signaling pathway
3. B	GO:0006897	endocytosis
3. B	GO:0070650	actin filament bundle distribution
3. B	GO:0098904	regulation of AV node cell action potential
3. B	GO:0072116	pronephros formation
3. B	GO:0055008	cardiac muscle tissue morphogenesis
3. B	GO:0006887	exocytosis
3. B	GO:0071314	cellular response to cocaine
3. B	GO:2000096	positive regulation of Wnt signaling pathway, planar cell polarity pathway
3. B	GO:0046875	ephrin receptor binding
3. B	GO:0010366	negative regulation of ethylene biosynthetic process
3. B	GO:0016604	nuclear body
3. B	GO:1904901	positive regulation of myosin II filament organization
3. B	GO:0098907	regulation of SA node cell action potential
3. B	GO:0003408	optic cup formation involved in camera-type eye development
3. B	GO:0070528	protein kinase C signaling
3. B	GO:0001558	regulation of cell growth
3. B	GO:0046928	regulation of neurotransmitter secretion
3. B	GO:0005516	calmodulin binding
3. B	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading
3. B	GO:0001568	blood vessel development
3. B	GO:0003677	DNA binding
3. B	GO:0010875	positive regulation of cholesterol efflux
3. B	GO:0045746	negative regulation of Notch signaling pathway
3. B	GO:0030155	regulation of cell adhesion
3. B	GO:0086014	atrial cardiac muscle cell action potential
3. B	GO:0097604	temperature-gated cation channel activity
3. B	GO:0070213	protein auto-ADP-ribosylation
3. B	GO:0004672	protein kinase activity
3. B	GO:0051973	positive regulation of telomerase activity
3. B	GO:0030507	spectrin binding
3. B	GO:0043330	response to exogenous dsRNA
3. B	GO:0099523	presynaptic cytosol
3. B	GO:0048812	neuron projection morphogenesis
3. B	GO:0033292	T-tubule organization
3. B	GO:0005769	early endosome
3. B	GO:1904908	negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric
3. B	GO:0071356	cellular response to tumor necrosis factor
3. B	GO:0051117	ATPase binding
3. B	GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding
3. B	GO:0070936	protein K48-linked ubiquitination
3. B	GO:0070682	proteasome regulatory particle assembly
3. B	GO:1904108	protein localization to ciliary inversin compartment
3. B	GO:0070412	R-SMAD binding
3. B	GO:0006915	apoptotic process
3. B	GO:0051017	actin filament bundle assembly
3. B	GO:0032495	response to muramyl dipeptide
3. B	GO:0048148	behavioral response to cocaine
3. B	GO:0106311
3. B	GO:0071889	14-3-3 protein binding
3. B	GO:0006606	protein import into nucleus
3. B	GO:0014069	postsynaptic density
3. B	GO:0043406	positive regulation of MAP kinase activity
3. B	GO:0070431	nucleotide-binding oligomerization domain containing 2 signaling pathway
3. B	GO:0001954	positive regulation of cell-matrix adhesion
3. B	GO:0090521	glomerular visceral epithelial cell migration
3. B	GO:0031436	BRCA1-BARD1 complex
3. B	GO:0051726	regulation of cell cycle
3. B	GO:0035844	cloaca development
3. B	GO:0014912	negative regulation of smooth muscle cell migration
3. B	GO:0006469	negative regulation of protein kinase activity
3. B	GO:0071407	cellular response to organic cyclic compound
3. B	GO:0099092	postsynaptic density, intracellular component
3. B	GO:0045211	postsynaptic membrane
3. B	GO:0043266	regulation of potassium ion transport
3. B	GO:0010976	positive regulation of neuron projection development
3. B	GO:0090083	regulation of inclusion body assembly
3. B	GO:1902412	regulation of mitotic cytokinesis
3. B	GO:0050955	thermoception
3. B	GO:0030017	sarcomere
3. B	GO:0032270	positive regulation of cellular protein metabolic process
3. B	GO:1902902	negative regulation of autophagosome assembly
3. B	GO:0043491	protein kinase B signaling
3. B	GO:0050772	positive regulation of axonogenesis
3. B	GO:0016055	Wnt signaling pathway
3. B	GO:2000651	positive regulation of sodium ion transmembrane transporter activity
3. B	GO:0048815	hermaphrodite genitalia morphogenesis
3. B	GO:0061195	taste bud formation
3. B	GO:0032288	myelin assembly
3. B	GO:0005622	intracellular anatomical structure
3. B	GO:0140031	phosphorylation-dependent protein binding
3. B	GO:0001934	positive regulation of protein phosphorylation
3. B	GO:0086091	regulation of heart rate by cardiac conduction
3. B	GO:0031670	cellular response to nutrient
3. B	GO:0019208	phosphatase regulator activity
3. B	GO:0090090	negative regulation of canonical Wnt signaling pathway
3. B	GO:0030315	T-tubule
3. B	GO:0055117	regulation of cardiac muscle contraction
3. B	GO:0071345	cellular response to cytokine stimulus
3. B	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
3. B	GO:0030424	axon
3. B	GO:0007409	axonogenesis
3. B	GO:0090263	positive regulation of canonical Wnt signaling pathway
3. B	GO:0043069	negative regulation of programmed cell death
3. B	GO:1902260	negative regulation of delayed rectifier potassium channel activity
3. B	GO:0010888	negative regulation of lipid storage
3. B	GO:0031430	M band
3. B	GO:0045995	regulation of embryonic development
3. B	GO:0070198	protein localization to chromosome, telomeric region
3. B	GO:0031253	cell projection membrane
3. B	GO:0010761	fibroblast migration
3. B	GO:0007030	Golgi organization
3. B	GO:0031672	A band
3. B	GO:0045838	positive regulation of membrane potential
3. B	GO:0098910	regulation of atrial cardiac muscle cell action potential
3. B	GO:0043194	axon initial segment
3. B	GO:0036371	protein localization to T-tubule
3. B	GO:0048662	negative regulation of smooth muscle cell proliferation
3. B	GO:0099527	postsynapse to nucleus signaling pathway
3. B	GO:0044030	regulation of DNA methylation
3. B	GO:0070742	C2H2 zinc finger domain binding
3. B	GO:0016279	protein-lysine N-methyltransferase activity
3. B	GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator
3. B	GO:0010424	DNA methylation on cytosine within a CG sequence
3. B	GO:0010745	negative regulation of macrophage derived foam cell differentiation
3. B	GO:1904355	positive regulation of telomere capping
3. B	GO:0014731	spectrin-associated cytoskeleton
3. B	GO:0033270	paranode region of axon
3. B	GO:0098978	glutamatergic synapse
3. B	GO:0072114	pronephros morphogenesis
3. B	GO:0071560	cellular response to transforming growth factor beta stimulus
3. B	GO:0045184	establishment of protein localization
3. B	GO:0061630	ubiquitin protein ligase activity
3. B	GO:0017124	SH3 domain binding
3. B	GO:0097543	ciliary inversin compartment
3. B	GO:0010882	regulation of cardiac muscle contraction by calcium ion signaling
3. B	GO:0043005	neuron projection
3. B	GO:2001257	regulation of cation channel activity
3. B	GO:0098871	postsynaptic actin cytoskeleton
3. B	GO:0097435	supramolecular fiber organization
3. B	GO:0016323	basolateral plasma membrane
3. B	GO:0097120	receptor localization to synapse
3. B	GO:0046822	regulation of nucleocytoplasmic transport
3. B	GO:0014704	intercalated disc
3. B	GO:0007098	centrosome cycle
3. B	GO:0019901	protein kinase binding
3. B	GO:0099519	dense core granule cytoskeletal transport
3. B	GO:0007219	Notch signaling pathway
3. B	GO:0001658	branching involved in ureteric bud morphogenesis
3. B	GO:0009610	response to symbiotic fungus
3. B	GO:0035265	organ growth
3. B	GO:0010881	regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
3. B	GO:0042383	sarcolemma
3. B	GO:0021546	rhombomere development
3. B	GO:0003190	atrioventricular valve formation
3. B	GO:0070427	nucleotide-binding oligomerization domain containing 1 signaling pathway
3. B	GO:0030030	cell projection organization
3. B	GO:0050931	pigment cell differentiation
3. B	GO:0043001	Golgi to plasma membrane protein transport
3. B	GO:0046976	histone methyltransferase activity (H3-K27 specific)
3. B	GO:0032212	positive regulation of telomere maintenance via telomerase
3. B	GO:1905274	regulation of modification of postsynaptic actin cytoskeleton
3. B	GO:0007569	cell aging
3. B	GO:0007130	synaptonemal complex assembly
3. B	GO:0005856	cytoskeleton
3. B	GO:0061001	regulation of dendritic spine morphogenesis
3. B	GO:0060236	regulation of mitotic spindle organization
3. B	GO:0043195	terminal bouton
3. B	GO:2000279	negative regulation of DNA biosynthetic process
3. B	GO:0032580	Golgi cisterna membrane
3. B	GO:0035914	skeletal muscle cell differentiation
3. B	GO:0061025	membrane fusion
3. B	GO:0016529	sarcoplasmic reticulum
3. B	GO:0050968	detection of chemical stimulus involved in sensory perception of pain
3. B	GO:0007229	integrin-mediated signaling pathway
3. B	GO:0031542	positive regulation of anthocyanin biosynthetic process
3. B	GO:1904743	negative regulation of telomeric DNA binding
3. B	GO:0071347	cellular response to interleukin-1
3. B	GO:1900383	regulation of synaptic plasticity by receptor localization to synapse
3. B	GO:0072660	maintenance of protein location in plasma membrane
3. B	GO:0090314	positive regulation of protein targeting to membrane
3. B	GO:0009967	positive regulation of signal transduction
3. B	GO:0086004	regulation of cardiac muscle cell contraction
3. B	GO:0048013	ephrin receptor signaling pathway
3. B	GO:2000134	negative regulation of G1/S transition of mitotic cell cycle
3. B	GO:1901019	regulation of calcium ion transmembrane transporter activity
3. B	GO:0031625	ubiquitin protein ligase binding
3. B	GO:0043197	dendritic spine
3. B	GO:0045162	clustering of voltage-gated sodium channels
3. B	GO:0002009	morphogenesis of an epithelium
3. B	GO:1901187	regulation of ephrin receptor signaling pathway
3. B	GO:0008285	negative regulation of cell population proliferation
3. B	GO:0051865	protein autoubiquitination
3. B	GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity
3. B	GO:0048920	posterior lateral line neuromast primordium migration
3. B	GO:0033209	tumor necrosis factor-mediated signaling pathway
3. B	GO:0030027	lamellipodium
3. B	GO:0008139	nuclear localization sequence binding
3. B	GO:0036309	protein localization to M-band
3. B	GO:0033268	node of Ranvier
3. B	GO:0048665	neuron fate specification
3. B	GO:0035507	regulation of myosin-light-chain-phosphatase activity
3. B	GO:0050807	regulation of synapse organization
3. B	GO:1903527	positive regulation of membrane tubulation
3. B	GO:0034394	protein localization to cell surface
3. B	GO:0008092	cytoskeletal protein binding
3. B	GO:0071709	membrane assembly
3. B	GO:0086069	bundle of His cell to Purkinje myocyte communication
3. B	GO:0045732	positive regulation of protein catabolic process
3. B	GO:0034446	substrate adhesion-dependent cell spreading
3. B	GO:0051924	regulation of calcium ion transport
3. B	GO:0032088	negative regulation of NF-kappaB transcription factor activity
3. B	GO:0085042	periarbuscular membrane
3. B	GO:0060992	response to fungicide
3. B	GO:0030673	axolemma
3. B	GO:0031432	titin binding
3. B	GO:0019899	enzyme binding
3. B	GO:0051928	positive regulation of calcium ion transport
3. B	GO:0034112	positive regulation of homotypic cell-cell adhesion
3. B	GO:0021508	floor plate formation
3. B	GO:0034613	cellular protein localization
3. B	GO:0051570	regulation of histone H3-K9 methylation
3. B	GO:0006471	protein ADP-ribosylation
3. B	GO:0004857	enzyme inhibitor activity
3. B	GO:0086070	SA node cell to atrial cardiac muscle cell communication
3. B	GO:0005200	structural constituent of cytoskeleton
3. B	GO:1901018	positive regulation of potassium ion transmembrane transporter activity
3. B	GO:0050714	positive regulation of protein secretion
3. B	GO:0048859	formation of anatomical boundary
3. B	GO:0042327	positive regulation of phosphorylation
3. B	GO:0031663	lipopolysaccharide-mediated signaling pathway
3. B	GO:0070972	protein localization to endoplasmic reticulum
3. B	GO:0043268	positive regulation of potassium ion transport
3. B	GO:0086066	atrial cardiac muscle cell to AV node cell communication
3. B	GO:1901021	positive regulation of calcium ion transmembrane transporter activity
3. B	GO:0016021	integral component of membrane
3. B	GO:0031267	small GTPase binding
3. B	GO:0060035	notochord cell development
3. B	GO:0005925	focal adhesion
3. B	GO:0021654	rhombomere boundary formation
3. B	GO:0045685	regulation of glial cell differentiation
3. B	GO:0030513	positive regulation of BMP signaling pathway
3. B	GO:0033256	I-kappaB/NF-kappaB complex
3. B	GO:0032991	protein-containing complex
3. B	GO:0005829	cytosol
3. B	GO:0046872	metal ion binding
3. B	GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity
3. B	GO:0042281	dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase activity
3. B	GO:0055002	striated muscle cell development
3. B	GO:0035544	negative regulation of SNARE complex assembly
3. B	GO:0035508	positive regulation of myosin-light-chain-phosphatase activity
3. B	GO:0007528	neuromuscular junction development
3. B	GO:0000062	fatty-acyl-CoA binding
3. B	GO:0002102	podosome
3. B	GO:0000139	Golgi membrane
3. B	GO:1900827	positive regulation of membrane depolarization during cardiac muscle cell action potential
3. B	GO:0035556	intracellular signal transduction
3. B	GO:0048892	lateral line nerve development
3. B	GO:0045807	positive regulation of endocytosis
3. B	GO:0098686	hippocampal mossy fiber to CA3 synapse
3. B	GO:0042326	negative regulation of phosphorylation
3. B	GO:0008093	cytoskeletal anchor activity
3. B	GO:0010667	negative regulation of cardiac muscle cell apoptotic process
3. B	GO:0048916	posterior lateral line development
3. B	GO:0005938	cell cortex
3. B	GO:0045773	positive regulation of axon extension
3. B	GO:1904357	negative regulation of telomere maintenance via telomere lengthening
3. B	GO:1901224	positive regulation of NIK/NF-kappaB signaling
3. B	GO:0030674	protein-macromolecule adaptor activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q8BY98	Ankyrin repeat domain-containing protein SOWAHD	1.48e-04	3.26e-05	4.99e-31
1. PB	A6NJG2	Ankyrin repeat domain-containing protein SOWAHD	7.42e-06	1.11e-05	8.36e-26
1. PB	Q8BLS7	Ankyrin repeat domain-containing protein SOWAHA	6.71e-05	3.88e-34	1.40e-41
1. PB	Q53LP3	Ankyrin repeat domain-containing protein SOWAHC	0	8.93e-156	0.0
1. PB	Q8C0J6	Ankyrin repeat domain-containing protein SOWAHC	9.01e-09	3.19e-76	0.0
1. PB	Q2M3V2	Ankyrin repeat domain-containing protein SOWAHA	6.53e-04	9.63e-34	2.11e-30
2. P	Q6F3J0	Nuclear factor NF-kappa-B p105 subunit	2.31e-01	8.29e-03	NA
2. P	Q3S405	Transcription factor SWI6	7.73e-02	2.42e-03	NA
2. P	Q04861	Nuclear factor NF-kappa-B p105 subunit	2.43e-01	2.80e-02	NA
2. P	O73630	Nuclear factor NF-kappa-B p100 subunit	1.51e-01	1.03e-04	NA
2. P	P09959	Regulatory protein SWI6	1.80e-01	1.89e-04	NA
2. P	P98150	Nuclear factor NF-kappa-B p100 subunit	2.16e-01	4.18e-03	NA
2. P	P39678	Transcription factor MBP1	2.89e-02	5.77e-04	NA
2. P	P40418	Regulatory protein SWI6	7.15e-02	2.62e-02	NA
2. P	Q9WTK5	Nuclear factor NF-kappa-B p100 subunit	1.19e-01	3.93e-02	NA
2. P	G4NID8	Transcription factor SWI6	1.46e-01	2.42e-03	NA
2. P	Q00653	Nuclear factor NF-kappa-B p100 subunit	1.79e-01	8.97e-03	NA
2. P	P39679	Transcription factor MBP1	4.15e-02	1.68e-05	NA
2. P	Q4KL97	Ankyrin repeat domain-containing protein 1	1.04e-03	2.25e-03	NA
2. P	P20749	B-cell lymphoma 3 protein	1.25e-03	1.77e-02	NA
2. P	Q9GZV1	Ankyrin repeat domain-containing protein 2	2.35e-02	3.07e-02	NA
2. P	Q03017	NF-kappa-B inhibitor cactus	7.34e-02	6.17e-06	NA
2. P	P83757	NF-kappa-B inhibitor cactus	NA	2.42e-06	NA
2. P	P41412	Cell division cycle-related protein res2/pct1	1.02e-01	4.35e-02	NA
2. P	P01129	Start control protein cdc10	4.45e-02	4.04e-02	NA
3. B	A2VDR2	Acyl-CoA-binding domain-containing protein 6	5.85e-03	NA	0.001
3. B	Q9BGT9	Ankyrin repeat and SOCS box protein 7	1.11e-04	NA	5.88e-05
3. B	Q8N9V6	Ankyrin repeat domain-containing protein 53	7.03e-03	NA	0.002
3. B	Q00PJ1	Cortactin-binding protein 2	3.52e-01	NA	0.002
3. B	Q8BX02	KN motif and ankyrin repeat domain-containing protein 2	2.87e-01	NA	0.011
3. B	Q07DZ5	Cortactin-binding protein 2	1.66e-01	NA	0.004
3. B	Q2TXF6	Ankyrin repeat domain-containing protein oryK	2.35e-01	NA	0.017
3. B	Q15327	Ankyrin repeat domain-containing protein 1	9.85e-03	NA	0.021
3. B	Q80SY4	E3 ubiquitin-protein ligase MIB1	1.66e-01	NA	5.85e-06
3. B	Q54KA7	Ankyrin repeat, PH and SEC7 domain containing protein secG	8.36e-02	NA	0.002
3. B	Q810N6	Ankyrin repeat domain-containing protein 45	1.35e-02	NA	4.29e-04
3. B	Q02989	Alpha-latroinsectotoxin-Lt1a (Fragment)	1.74e-01	NA	0.004
3. B	P16157	Ankyrin-1	5.17e-01	NA	4.99e-04
3. B	O14974	Protein phosphatase 1 regulatory subunit 12A	7.29e-02	NA	0.019
3. B	Q337A0	Probable E3 ubiquitin-protein ligase XBOS33	1.81e-02	NA	0.006
3. B	D3ZD05	KN motif and ankyrin repeat domain-containing protein 2	3.48e-02	NA	0.004
3. B	Q86YT6	E3 ubiquitin-protein ligase MIB1	1.99e-01	NA	7.13e-06
3. B	P57078	Receptor-interacting serine/threonine-protein kinase 4	4.69e-02	NA	0.001
3. B	O95271	Poly [ADP-ribose] polymerase tankyrase-1	8.92e-02	NA	0.030
3. B	Q9TZC4	Integrin-linked protein kinase homolog pat-4	3.51e-03	NA	0.036
3. B	O89019	Inversin	2.19e-01	NA	0.002
3. B	Q9Y575	Ankyrin repeat and SOCS box protein 3	9.87e-04	NA	0.023
3. B	Q53RE8	Ankyrin repeat domain-containing protein 39	1.24e-03	NA	8.77e-04
3. B	G0LXV8	Alpha-latrotoxin-Lh1a (Fragment)	3.01e-01	NA	0.002
3. B	Q9EP71	Ankycorbin	3.40e-02	NA	0.004
3. B	Q4FE45	E3 ubiquitin-protein ligase XBAT33	2.15e-02	NA	0.007
3. B	Q2QLB3	Cortactin-binding protein 2	7.48e-01	NA	4.97e-05
3. B	D3J162	Protein VAPYRIN	2.25e-01	NA	1.34e-04
3. B	Q69ZU8	Ankyrin repeat domain-containing protein 6	1.91e-02	NA	0.001
3. B	Q0P5B9	Ankyrin repeat domain-containing protein 39	5.98e-04	NA	0.002
3. B	Q6PFX9	Poly [ADP-ribose] polymerase tankyrase-1	1.16e-01	NA	0.032
3. B	O55222	Integrin-linked protein kinase	1.24e-02	NA	2.75e-04
3. B	Q2IBB2	Cortactin-binding protein 2	3.11e-01	NA	0.005
3. B	Q8MJ49	Osteoclast-stimulating factor 1	6.65e-04	NA	0.040
3. B	Q5ZLC6	Ankyrin repeat domain-containing protein 10	2.92e-03	NA	0.017
3. B	C7B178	Protein VAPYRIN	2.14e-01	NA	2.80e-05
3. B	Q07E41	Cortactin-binding protein 2	4.13e-01	NA	0.001
3. B	Q4V8X4	Acyl-CoA-binding domain-containing protein 6	1.32e-02	NA	0.004
3. B	Q2QLG9	Cortactin-binding protein 2	1.41e-01	NA	2.02e-05
3. B	Q09YI1	Cortactin-binding protein 2	3.02e-01	NA	5.13e-04
3. B	Q8VHK2	Caskin-1	2.80e-01	NA	0.001
3. B	O15084	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A	7.72e-02	NA	3.84e-04
3. B	Q60772	Cyclin-dependent kinase 4 inhibitor C	5.46e-05	NA	0.037
3. B	Q96AX9	E3 ubiquitin-protein ligase MIB2	2.25e-01	NA	2.75e-05
3. B	Q02357	Ankyrin-1	3.58e-01	NA	5.86e-04
3. B	O44997	Death-associated protein kinase dapk-1	3.72e-01	NA	7.04e-04
3. B	Q8BTI7	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	2.21e-01	NA	0.011
3. B	Q6NRL1	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1	3.48e-01	NA	0.015
3. B	Q6ZVH7	Espin-like protein	2.69e-02	NA	0.006
3. B	Q5U312	Ankycorbin	4.51e-02	NA	0.012
3. B	Q65XV2	E3 ubiquitin-protein ligase XB3	5.12e-02	NA	0.026
3. B	Q9H9B1	Histone-lysine N-methyltransferase EHMT1	1.13e-01	NA	8.97e-05
3. B	Q99ME3	Synphilin-1	2.43e-01	NA	5.51e-05
3. B	Q07E28	Cortactin-binding protein 2	4.04e-01	NA	1.47e-05
3. B	P42773	Cyclin-dependent kinase 4 inhibitor C	1.45e-05	NA	0.002
3. B	B4E2M5	Ankyrin repeat domain-containing protein 66	2.25e-03	NA	0.013
3. B	Q28BK1	E3 ubiquitin-protein ligase HACE1	1.58e-01	NA	0.002
3. B	Q08353	NF-kappa-B inhibitor alpha	1.05e-02	NA	0.006
3. B	Q4JHE0	Probable E3 ubiquitin-protein ligase XBOS36	1.52e-02	NA	7.58e-05
3. B	G5E8K5	Ankyrin-3	4.43e-01	NA	2.51e-04
3. B	Q9VUX2	E3 ubiquitin-protein ligase mind-bomb	3.41e-01	NA	3.77e-05
3. B	Q5GIG6	Serine/threonine-protein kinase TNNI3K	2.69e-02	NA	0.008
3. B	Q92625	Ankyrin repeat and SAM domain-containing protein 1A	1.12e-01	NA	0.024
3. B	A0M8T5	Cortactin-binding protein 2	3.14e-01	NA	1.52e-05
3. B	Q6DD51	Caskin-2	5.30e-01	NA	1.76e-04
3. B	Q07E15	Cortactin-binding protein 2	4.17e-01	NA	4.68e-05
3. B	Q9ERK0	Receptor-interacting serine/threonine-protein kinase 4	6.36e-02	NA	5.56e-04
3. B	O70511	Ankyrin-3	8.14e-01	NA	1.47e-04
3. B	Q90623	Protein phosphatase 1 regulatory subunit 12A	5.63e-01	NA	0.013
3. B	Q09YJ3	Cortactin-binding protein 2	3.22e-01	NA	5.13e-04
3. B	Q12955	Ankyrin-3	NA	NA	6.30e-05
3. B	Q3U0D9	E3 ubiquitin-protein ligase HACE1	1.30e-01	NA	0.003
3. B	Q5TZF3	Ankyrin repeat domain-containing protein 45	1.51e-02	NA	0.003
3. B	Q7EZ44	Probable E3 ubiquitin-protein ligase XBOS35	4.89e-02	NA	1.23e-04
3. B	Q9Z2X3	26S proteasome non-ATPase regulatory subunit 10	2.09e-05	NA	0.021
3. B	Q63746	NF-kappa-B inhibitor alpha	1.14e-02	NA	0.005
3. B	Q6XJU9	Osteoclast-stimulating factor 1	8.17e-04	NA	0.014
3. B	Q10728	Protein phosphatase 1 regulatory subunit 12A	7.14e-02	NA	0.018
3. B	Q3V0J4	Ankyrin repeat domain-containing protein 53	5.83e-02	NA	0.001
3. B	Q7Z6G8	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	1.26e-01	NA	0.024
3. B	Q07DV1	Cortactin-binding protein 2	3.29e-01	NA	0.043
3. B	Q5R5V4	Integrin-linked protein kinase	6.24e-03	NA	2.50e-04
3. B	O75762	Transient receptor potential cation channel subfamily A member 1	2.25e-01	NA	0.010
3. B	Q10311	Ankyrin repeat-containing protein C6C3.08	5.18e-07	NA	0.036
3. B	Q9FNP4	Phytochrome-interacting ankyrin-repeat protein 2	7.85e-06	NA	0.040
3. B	Q04749	Target of rapamycin complex 2 subunit AVO2	2.07e-03	NA	1.96e-05
3. B	Q07DW4	Cortactin-binding protein 2	1.69e-01	NA	2.42e-04
3. B	A2A690	Protein TANC2	7.29e-01	NA	0.019
3. B	Q6KAE5	Probable E3 ubiquitin-protein ligase XBOS32	1.80e-02	NA	5.76e-05
3. B	Q9QWY8	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1	4.95e-01	NA	0.005
3. B	Q9TZM3	Leucine-rich repeat serine/threonine-protein kinase 1	3.77e-01	NA	3.06e-05
3. B	Q6NY19	KN motif and ankyrin repeat domain-containing protein 3	8.83e-02	NA	2.64e-04
3. B	Q63ZY3	KN motif and ankyrin repeat domain-containing protein 2	1.47e-01	NA	0.007
3. B	Q07DX4	Cortactin-binding protein 2	5.07e-01	NA	0.014
3. B	Q9CR42	Ankyrin repeat domain-containing protein 1	4.99e-02	NA	0.012
3. B	A0M8S4	Cortactin-binding protein 2	2.71e-01	NA	4.15e-05
3. B	Q9Z1E3	NF-kappa-B inhibitor alpha	3.53e-03	NA	0.002
3. B	Q09YK4	Cortactin-binding protein 2	3.87e-01	NA	2.06e-04
3. B	Q8C8R3	Ankyrin-2	NA	NA	1.63e-04
3. B	E1C656	E3 ubiquitin-protein ligase HACE1	7.29e-02	NA	0.001
3. B	Q9TU71	Ankyrin repeat domain-containing protein 1	6.29e-03	NA	0.008
3. B	Q96NW4	Ankyrin repeat domain-containing protein 27	1.40e-01	NA	0.012
3. B	Q8BZW2	Ankyrin repeat domain-containing protein SOWAHB	1.10e-02	NA	1.49e-28
3. B	Q2QLA2	Cortactin-binding protein 2	1.28e-01	NA	0.011
3. B	Q9D2X0	Ankyrin repeat domain-containing protein 39	1.14e-03	NA	0.002
3. B	Q8BIZ1	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	4.06e-01	NA	0.016
3. B	Q6AWW5	Ankyrin repeat-containing protein At5g02620	3.12e-02	NA	0.036
3. B	Q6P9K8	Caskin-1	4.09e-01	NA	0.001
3. B	A6NEL2	Ankyrin repeat domain-containing protein SOWAHB	4.04e-03	NA	1.08e-28
3. B	Q8WXE0	Caskin-2	2.69e-01	NA	2.28e-05
3. B	Q2IBA2	Cortactin-binding protein 2	1.29e-01	NA	4.15e-05
3. B	Q9D061	Acyl-CoA-binding domain-containing protein 6	6.59e-03	NA	0.008
3. B	A3AYR1	Acyl-CoA-binding domain-containing protein 4	3.51e-02	NA	0.030
3. B	Q5DW34	Histone-lysine N-methyltransferase EHMT1	1.27e-01	NA	1.99e-04
3. B	Q07DY4	Cortactin-binding protein 2	2.98e-01	NA	4.41e-05
3. B	Q3SWY2	Integrin-linked protein kinase	4.05e-03	NA	2.43e-04
3. B	Q80YE7	Death-associated protein kinase 1	3.78e-01	NA	0.001
3. B	Q06547	GA-binding protein subunit beta-1	2.19e-02	NA	0.042
3. B	A1X157	Cortactin-binding protein 2	2.18e-01	NA	2.38e-05
3. B	Q9HCD6	Protein TANC2	5.23e-01	NA	0.015
3. B	Q9Z148	Histone-lysine N-methyltransferase EHMT2	4.40e-01	NA	1.32e-05
3. B	P0DJE3	Alpha-latrotoxin-Lhe1a	2.44e-01	NA	3.17e-04
3. B	Q5RCK5	Ankyrin repeat and SOCS box protein 7	2.79e-03	NA	4.50e-05
3. B	Q96KQ7	Histone-lysine N-methyltransferase EHMT2	2.21e-01	NA	8.30e-06
3. B	Q99J82	Integrin-linked protein kinase	4.10e-03	NA	2.75e-04
3. B	Q2IBF7	Cortactin-binding protein 2	3.24e-01	NA	0.006
3. B	Q8UVC1	Inversin	8.27e-02	NA	0.016
3. B	Q2QLF8	Cortactin-binding protein 2	3.52e-01	NA	0.039
3. B	Q9HFE7	Ankyrin repeat-containing protein P16F5.05c	9.48e-07	NA	0.002
3. B	Q2IBD4	Cortactin-binding protein 2	2.93e-01	NA	0.007
3. B	Q92882	Osteoclast-stimulating factor 1	7.27e-04	NA	0.024
3. B	Q6GNY1	E3 ubiquitin-protein ligase mib1	2.61e-01	NA	1.45e-05
3. B	Q91ZU0	Ankyrin repeat and SOCS box protein 7	1.87e-03	NA	6.04e-05
3. B	Q1AAU6	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1	4.82e-01	NA	0.005
3. B	Q3UYR4	Espin-like protein	3.83e-02	NA	0.002
3. B	Q4UMH6	Putative ankyrin repeat protein RF_0381	4.60e-01	NA	0.027
3. B	Q804S5	E3 ubiquitin-protein ligase mib1	2.77e-01	NA	7.05e-06
3. B	B9EJA2	Cortactin-binding protein 2	3.91e-01	NA	8.43e-04
3. B	Q8IYU2	E3 ubiquitin-protein ligase HACE1	1.29e-01	NA	0.004
3. B	X1WE18	KN motif and ankyrin repeat domain-containing protein 2	1.00e-01	NA	0.034
3. B	Q13625	Apoptosis-stimulating of p53 protein 2	3.38e-01	NA	1.35e-04
3. B	Q9HLN1	Putative ankyrin repeat protein Ta0196	1.35e-03	NA	0.027
3. B	Q9Y2G4	Ankyrin repeat domain-containing protein 6	1.74e-02	NA	0.014
3. B	Q91974	NF-kappa-B inhibitor alpha	1.00e-02	NA	0.008
3. B	Q2IBF8	Cortactin-binding protein 2	3.30e-01	NA	0.007
3. B	Q8NB46	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	1.35e-01	NA	0.012
3. B	Q9ULJ7	Ankyrin repeat domain-containing protein 50	1.22e-01	NA	0.047
3. B	P25963	NF-kappa-B inhibitor alpha	7.32e-03	NA	0.005
3. B	P0C927	Ankyrin repeat and SOCS box protein 14	7.28e-02	NA	0.004
3. B	Q9H672	Ankyrin repeat and SOCS box protein 7	1.01e-04	NA	5.57e-05
3. B	Q108T9	Cortactin-binding protein 2	3.00e-01	NA	0.005
3. B	F1LTE0	Protein TANC2	6.82e-01	NA	0.018
3. B	Q8CG79	Apoptosis-stimulating of p53 protein 2	8.68e-02	NA	1.35e-04
3. B	Q5ZIJ9	E3 ubiquitin-protein ligase MIB2	1.44e-01	NA	1.93e-04
3. B	Q05921	2-5A-dependent ribonuclease	3.33e-02	NA	5.01e-04
3. B	Q8UVC3	Inversin	4.11e-01	NA	5.65e-04
3. B	Q8BZ25	Ankyrin repeat and protein kinase domain-containing protein 1	2.97e-01	NA	8.64e-04
3. B	Q8VHK1	Caskin-2	4.26e-01	NA	1.91e-05
3. B	Q6JAN1	Inversin	2.07e-01	NA	3.89e-04
3. B	Q5RJK8	Acyl-CoA-binding domain-containing protein 6	8.61e-03	NA	0.027
3. B	O97902	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1	4.75e-01	NA	0.041
3. B	D3ZBM7	E3 ubiquitin-protein ligase HACE1	1.21e-01	NA	0.004
3. B	Q2IBE6	Cortactin-binding protein 2	1.16e-01	NA	0.011
3. B	Q05823	2-5A-dependent ribonuclease	2.49e-02	NA	0.032
3. B	Q80VM7	Ankyrin repeat domain-containing protein 24	1.00e-01	NA	0.006
3. B	P57044	Integrin-linked protein kinase	3.62e-03	NA	2.65e-04
3. B	Q09YG9	Cortactin-binding protein 2	2.19e-01	NA	0.042
3. B	P23631	Alpha-latrotoxin-Lt1a	3.29e-01	NA	0.001
3. B	Q14678	KN motif and ankyrin repeat domain-containing protein 1	9.70e-02	NA	0.011
3. B	Q52T38	Protein S-acyltransferase 24	3.07e-02	NA	0.020
3. B	Q8WXD9	Caskin-1	4.98e-01	NA	0.002
3. B	Q8R560	Ankyrin repeat domain-containing protein 1	1.45e-02	NA	0.016
3. B	P46683	Ankyrin repeat-containing protein YAR1	1.27e-05	NA	1.52e-04
3. B	P0C6S7	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	5.95e-01	NA	0.007
3. B	Q5ZLC8	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	3.19e-01	NA	0.014
3. B	Q505D1	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A	1.33e-01	NA	3.77e-04
3. B	Q68LP1	E3 ubiquitin-protein ligase MIB2	4.03e-02	NA	5.65e-06
3. B	Q01484	Ankyrin-2	NA	NA	2.07e-04
3. B	F1N6G5	E3 ubiquitin-protein ligase HACE1	3.40e-01	NA	0.004
3. B	Q8WZ74	Cortactin-binding protein 2	2.81e-01	NA	0.005
3. B	Q54GC8	Acyl-CoA-binding domain-containing protein 6 homolog	5.19e-05	NA	0.002
3. B	Q9DF58	Integrin-linked protein kinase	3.39e-03	NA	2.61e-04
3. B	Q865U8	Ankyrin repeat domain-containing protein 1	8.33e-03	NA	0.020
3. B	Q8NFD2	Ankyrin repeat and protein kinase domain-containing protein 1	1.33e-01	NA	0.020
3. B	F8W2M1	E3 ubiquitin-protein ligase HACE1	3.33e-02	NA	0.001
3. B	Q6NLQ8	E3 ubiquitin-protein ligase XBAT32	1.83e-02	NA	0.002
3. B	Q6NRK3	Ankyrin repeat domain-containing protein SOWAHB	4.71e-03	NA	5.73e-28
3. B	Q6DRG7	Protein phosphatase 1 regulatory subunit 12A	5.40e-01	NA	0.014
3. B	Q9DBR7	Protein phosphatase 1 regulatory subunit 12A	8.72e-02	NA	0.020
3. B	Q7Z3H0	Photoreceptor ankyrin repeat protein	3.75e-02	NA	0.004
3. B	Q9Y283	Inversin	5.58e-02	NA	0.001
3. B	Q9Y6H5	Synphilin-1	1.61e-02	NA	3.83e-05
3. B	Q8R516	E3 ubiquitin-protein ligase MIB2	4.84e-02	NA	5.37e-06
3. B	Q6DCL5	E3 ubiquitin-protein ligase HACE1	1.13e-01	NA	0.002
3. B	Q2QL82	Cortactin-binding protein 2	2.24e-01	NA	6.36e-04
3. B	Q13418	Integrin-linked protein kinase	4.08e-03	NA	2.61e-04
3. B	Q1LZH7	KN motif and ankyrin repeat domain-containing protein 2	3.45e-02	NA	0.002
3. B	Q9BR61	Acyl-CoA-binding domain-containing protein 6	3.65e-03	NA	0.032
3. B	Q9FF09	Phytochrome-interacting ankyrin-repeat protein 1	5.74e-04	NA	0.011